Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   IMY14_RS13190 Genome accession   NZ_CP063150
Coordinates   2537820..2538203 (-) Length   127 a.a.
NCBI ID   WP_015384087.1    Uniprot ID   -
Organism   Bacillus subtilis strain s-16     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2532820..2543203
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IMY14_RS13150 sinI 2533755..2533928 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  IMY14_RS13155 sinR 2533962..2534297 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  IMY14_RS13160 tasA 2534390..2535175 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  IMY14_RS13165 sipW 2535239..2535811 (-) 573 WP_080030740.1 signal peptidase I SipW -
  IMY14_RS13170 tapA 2535795..2536556 (-) 762 WP_047182870.1 amyloid fiber anchoring/assembly protein TapA -
  IMY14_RS13175 yqzG 2536826..2537152 (+) 327 WP_047183570.1 YqzG/YhdC family protein -
  IMY14_RS13180 spoIITA 2537194..2537373 (-) 180 WP_003230176.1 YqzE family protein -
  IMY14_RS13185 comGG 2537445..2537819 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  IMY14_RS13190 comGF 2537820..2538203 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  IMY14_RS13195 comGE 2538229..2538576 (-) 348 WP_047182872.1 ComG operon protein 5 Machinery gene
  IMY14_RS13200 comGD 2538560..2538991 (-) 432 WP_015384089.1 comG operon protein ComGD Machinery gene
  IMY14_RS13205 comGC 2538981..2539277 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  IMY14_RS13210 comGB 2539291..2540328 (-) 1038 WP_047182873.1 comG operon protein ComGB Machinery gene
  IMY14_RS13215 comGA 2540315..2541385 (-) 1071 WP_015483431.1 competence protein ComGA Machinery gene
  IMY14_RS13225 corA 2541795..2542748 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14293.34 Da        Isoelectric Point: 5.1404

>NTDB_id=437117 IMY14_RS13190 WP_015384087.1 2537820..2538203(-) (comGF) [Bacillus subtilis strain s-16]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEDGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=437117 IMY14_RS13190 WP_015384087.1 2537820..2538203(-) (comGF) [Bacillus subtilis strain s-16]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGGATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCACTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984