Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   HBA75_RS18885 Genome accession   NZ_CP050183
Coordinates   3778883..3779662 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus thuringiensis strain HER1410     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3753587..3815403 3778883..3779662 within 0


Gene organization within MGE regions


Location: 3753587..3815403
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HBA75_RS18775 (HBA75_18790) - 3754158..3755057 (-) 900 WP_086411756.1 polysaccharide deacetylase family protein -
  HBA75_RS18780 (HBA75_18795) pnp 3755211..3757349 (-) 2139 WP_000076737.1 polyribonucleotide nucleotidyltransferase -
  HBA75_RS18785 (HBA75_18800) rpsO 3757510..3757779 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  HBA75_RS18790 (HBA75_18805) ribF 3757880..3758851 (-) 972 WP_000766706.1 bifunctional riboflavin kinase/FAD synthetase -
  HBA75_RS18795 (HBA75_18810) truB 3758895..3759818 (-) 924 WP_000399350.1 tRNA pseudouridine(55) synthase TruB -
  HBA75_RS18800 (HBA75_18815) rbfA 3759905..3760261 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  HBA75_RS18805 (HBA75_18820) - 3760277..3760558 (-) 282 WP_000582363.1 DUF503 family protein -
  HBA75_RS18810 (HBA75_18825) infB 3760555..3762615 (-) 2061 WP_000036343.1 translation initiation factor IF-2 -
  HBA75_RS18815 (HBA75_18830) - 3762620..3762931 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  HBA75_RS18820 (HBA75_18835) - 3762932..3763204 (-) 273 WP_000071127.1 YlxR family protein -
  HBA75_RS18825 (HBA75_18840) nusA 3763216..3764322 (-) 1107 WP_000102604.1 transcription termination factor NusA -
  HBA75_RS18830 (HBA75_18845) rimP 3764340..3764810 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  HBA75_RS18835 (HBA75_18850) - 3765147..3769448 (-) 4302 WP_000060005.1 PolC-type DNA polymerase III -
  HBA75_RS18840 (HBA75_18855) - 3769573..3771273 (-) 1701 WP_000814300.1 proline--tRNA ligase -
  HBA75_RS18845 (HBA75_18860) rseP 3771383..3772639 (-) 1257 WP_001090243.1 RIP metalloprotease RseP -
  HBA75_RS18850 (HBA75_18865) dxr 3772657..3773799 (-) 1143 WP_000790373.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  HBA75_RS18855 (HBA75_18870) cdsA 3773823..3774614 (-) 792 WP_000813594.1 phosphatidate cytidylyltransferase -
  HBA75_RS18860 (HBA75_18875) uppS 3774632..3775408 (-) 777 WP_000971296.1 isoprenyl transferase -
  HBA75_RS18865 (HBA75_18880) frr 3775494..3776051 (-) 558 WP_000531501.1 ribosome recycling factor -
  HBA75_RS18870 (HBA75_18885) pyrH 3776054..3776776 (-) 723 WP_000042668.1 UMP kinase -
  HBA75_RS18875 (HBA75_18890) tsf 3776843..3777730 (-) 888 WP_001018578.1 translation elongation factor Ts -
  HBA75_RS18880 (HBA75_18895) rpsB 3777834..3778535 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  HBA75_RS18885 (HBA75_18900) codY 3778883..3779662 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  HBA75_RS18890 (HBA75_18905) hslU 3779740..3781131 (-) 1392 WP_000550078.1 ATP-dependent protease ATPase subunit HslU -
  HBA75_RS18895 (HBA75_18910) hslV 3781154..3781696 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  HBA75_RS18900 (HBA75_18915) xerC 3781739..3782638 (-) 900 WP_001101243.1 tyrosine recombinase XerC -
  HBA75_RS18905 (HBA75_18920) trmFO 3782704..3784008 (-) 1305 WP_000213002.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  HBA75_RS18910 (HBA75_18925) topA 3784057..3786135 (-) 2079 WP_001286963.1 type I DNA topoisomerase -
  HBA75_RS18915 (HBA75_18930) dprA 3786280..3787149 (-) 870 WP_000818043.1 DNA-processing protein DprA -
  HBA75_RS18920 (HBA75_18935) sucD 3787238..3788140 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  HBA75_RS18925 (HBA75_18940) sucC 3788160..3789320 (-) 1161 WP_001020791.1 ADP-forming succinate--CoA ligase subunit beta -
  HBA75_RS18930 (HBA75_18945) - 3789515..3790288 (-) 774 WP_001194265.1 ribonuclease HII -
  HBA75_RS18935 (HBA75_18950) ylqF 3790345..3791235 (-) 891 WP_000236704.1 ribosome biogenesis GTPase YlqF -
  HBA75_RS18940 (HBA75_18955) lepB 3791256..3791807 (-) 552 WP_000711853.1 signal peptidase I -
  HBA75_RS18945 (HBA75_18960) rplS 3791909..3792253 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  HBA75_RS18950 (HBA75_18965) trmD 3792400..3793134 (-) 735 WP_000686903.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  HBA75_RS18955 (HBA75_18970) rimM 3793134..3793649 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  HBA75_RS18960 (HBA75_18975) - 3793771..3793998 (-) 228 WP_000737401.1 KH domain-containing protein -
  HBA75_RS18965 (HBA75_18980) rpsP 3794013..3794285 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  HBA75_RS18970 (HBA75_18985) ffh 3794387..3795736 (-) 1350 WP_000863460.1 signal recognition particle protein -
  HBA75_RS18975 (HBA75_18990) - 3795749..3796081 (-) 333 WP_000891062.1 putative DNA-binding protein -
  HBA75_RS18980 (HBA75_18995) ftsY 3796215..3797204 (-) 990 WP_000007655.1 signal recognition particle-docking protein FtsY -
  HBA75_RS18985 (HBA75_19000) smc 3797220..3800789 (-) 3570 WP_086411757.1 chromosome segregation protein SMC -
  HBA75_RS18990 (HBA75_19005) rncS 3800936..3801673 (-) 738 WP_001146875.1 ribonuclease III -
  HBA75_RS18995 (HBA75_19010) acpP 3801732..3801965 (-) 234 WP_000786062.1 acyl carrier protein -
  HBA75_RS19000 (HBA75_19015) fabG 3802035..3802775 (-) 741 WP_000911773.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  HBA75_RS19005 (HBA75_19020) fabD 3802775..3803719 (-) 945 WP_086411758.1 ACP S-malonyltransferase -
  HBA75_RS19010 (HBA75_19025) plsX 3803734..3804726 (-) 993 WP_000684100.1 phosphate acyltransferase PlsX -
  HBA75_RS19015 (HBA75_19030) fapR 3804723..3805316 (-) 594 WP_000747348.1 transcription factor FapR -
  HBA75_RS19020 (HBA75_19035) recG 3805405..3807453 (-) 2049 WP_086411759.1 ATP-dependent DNA helicase RecG -
  HBA75_RS19025 (HBA75_19040) - 3807744..3809420 (-) 1677 WP_000027129.1 DAK2 domain-containing protein -
  HBA75_RS19030 (HBA75_19045) - 3809443..3809805 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  HBA75_RS19035 (HBA75_19050) rpmB 3810182..3810370 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  HBA75_RS19040 (HBA75_19055) spoVM 3810444..3810524 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  HBA75_RS19045 (HBA75_19060) - 3810591..3811271 (-) 681 WP_140159354.1 thiamine diphosphokinase -
  HBA75_RS19050 (HBA75_19065) rpe 3811341..3811985 (-) 645 WP_086411761.1 ribulose-phosphate 3-epimerase -
  HBA75_RS19055 (HBA75_19070) rsgA 3811988..3812869 (-) 882 WP_001113932.1 ribosome small subunit-dependent GTPase A -
  HBA75_RS19060 (HBA75_19075) pknB 3813116..3815143 (-) 2028 WP_174402556.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=430630 HBA75_RS18885 WP_000421290.1 3778883..3779662(-) (codY) [Bacillus thuringiensis strain HER1410]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=430630 HBA75_RS18885 WP_000421290.1 3778883..3779662(-) (codY) [Bacillus thuringiensis strain HER1410]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCGCGTAGTAAAGCTGTTGTTCAAATGGCAATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GCTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAAGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459