Detailed information    

insolico Bioinformatically predicted

Overview

Name   comF   Type   Machinery gene
Locus tag   G6R31_RS05245 Genome accession   NZ_CP049357
Coordinates   1039759..1040379 (+) Length   206 a.a.
NCBI ID   WP_017870400.1    Uniprot ID   A0AAV4K6H7
Organism   Deinococcus wulumuqiensis R12     
Function   ssDNA transport into the cell (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 985109..1042363 1039759..1040379 within 0


Gene organization within MGE regions


Location: 985109..1042363
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G6R31_RS04915 (G6R31_04915) - 985109..991171 (-) 6063 WP_081608174.1 phage tail tape measure protein -
  G6R31_RS04920 (G6R31_04920) - 991225..991668 (+) 444 WP_152423432.1 hypothetical protein -
  G6R31_RS16765 - 991806..992675 (-) 870 WP_040383953.1 HNH endonuclease signature motif containing protein -
  G6R31_RS04930 (G6R31_04930) - 992712..993038 (-) 327 WP_017869184.1 HNH endonuclease -
  G6R31_RS04935 (G6R31_04935) - 993092..993604 (-) 513 WP_017869185.1 hypothetical protein -
  G6R31_RS04940 (G6R31_04940) - 993601..993837 (-) 237 WP_017869186.1 hypothetical protein -
  G6R31_RS04945 (G6R31_04945) - 994009..994239 (+) 231 WP_017869187.1 helix-turn-helix transcriptional regulator -
  G6R31_RS04950 (G6R31_04950) - 994325..995200 (-) 876 WP_081608176.1 DUF4238 domain-containing protein -
  G6R31_RS04955 (G6R31_04955) - 995258..995611 (-) 354 WP_017869188.1 hypothetical protein -
  G6R31_RS04960 (G6R31_04960) - 995748..996212 (-) 465 WP_017869190.1 HK97 gp10 family phage protein -
  G6R31_RS04965 (G6R31_04965) - 996216..996569 (-) 354 WP_017869191.1 hypothetical protein -
  G6R31_RS04970 (G6R31_04970) - 996566..996982 (-) 417 WP_017869192.1 hypothetical protein -
  G6R31_RS04975 (G6R31_04975) - 997241..997924 (-) 684 WP_017869193.1 hypothetical protein -
  G6R31_RS04980 (G6R31_04980) - 997934..998386 (-) 453 WP_017869194.1 hypothetical protein -
  G6R31_RS04985 (G6R31_04985) - 998383..998622 (-) 240 WP_017869195.1 hypothetical protein -
  G6R31_RS04990 (G6R31_04990) - 998631..999005 (-) 375 WP_017869196.1 hypothetical protein -
  G6R31_RS04995 (G6R31_04995) - 999002..999385 (-) 384 WP_017869197.1 hypothetical protein -
  G6R31_RS05000 (G6R31_05000) - 999391..1000128 (-) 738 WP_152423433.1 hypothetical protein -
  G6R31_RS05005 (G6R31_05005) - 1000188..1001423 (-) 1236 WP_017869199.1 hypothetical protein -
  G6R31_RS05010 (G6R31_05010) - 1001503..1001955 (-) 453 WP_017869200.1 hypothetical protein -
  G6R31_RS05015 (G6R31_05015) - 1001952..1003280 (-) 1329 WP_017869201.1 hypothetical protein -
  G6R31_RS05020 (G6R31_05020) - 1003292..1003450 (-) 159 WP_017869202.1 hypothetical protein -
  G6R31_RS05025 (G6R31_05025) - 1003404..1004936 (-) 1533 WP_161617815.1 hypothetical protein -
  G6R31_RS05030 (G6R31_05030) - 1004914..1006338 (-) 1425 WP_152423434.1 hypothetical protein -
  G6R31_RS05035 (G6R31_05035) - 1006338..1006841 (-) 504 WP_017869205.1 hypothetical protein -
  G6R31_RS05040 (G6R31_05040) - 1006828..1007430 (-) 603 WP_017869206.1 hypothetical protein -
  G6R31_RS05045 (G6R31_05045) - 1007470..1008261 (+) 792 WP_152423435.1 hypothetical protein -
  G6R31_RS05050 (G6R31_05050) - 1008236..1008751 (-) 516 WP_017869208.1 ParB/RepB/Spo0J family partition protein -
  G6R31_RS05055 (G6R31_05055) - 1008748..1010109 (-) 1362 WP_017869209.1 DUF3440 domain-containing protein -
  G6R31_RS05060 (G6R31_05060) - 1010097..1010600 (-) 504 WP_017869210.1 hypothetical protein -
  G6R31_RS05065 (G6R31_05065) - 1010759..1011547 (-) 789 WP_017869211.1 phosphoadenosine phosphosulfate reductase family protein -
  G6R31_RS05070 (G6R31_05070) - 1011547..1012281 (-) 735 WP_200858951.1 hypothetical protein -
  G6R31_RS05075 (G6R31_05075) - 1012278..1013135 (-) 858 WP_025566561.1 ParB N-terminal domain-containing protein -
  G6R31_RS05080 (G6R31_05080) - 1013681..1014319 (-) 639 WP_026138660.1 phospholipase A2 -
  G6R31_RS05085 (G6R31_05085) - 1014470..1017949 (-) 3480 WP_025566563.1 DNA methyltransferase -
  G6R31_RS05090 (G6R31_05090) - 1018208..1019689 (-) 1482 WP_017869215.1 hypothetical protein -
  G6R31_RS05095 (G6R31_05095) - 1019686..1020048 (-) 363 WP_017869216.1 hypothetical protein -
  G6R31_RS05100 (G6R31_05100) - 1020045..1020494 (-) 450 WP_017869217.1 VRR-NUC domain-containing protein -
  G6R31_RS05105 (G6R31_05105) - 1020500..1020808 (-) 309 WP_017869218.1 hypothetical protein -
  G6R31_RS05110 (G6R31_05110) - 1020795..1021559 (-) 765 WP_017869219.1 hypothetical protein -
  G6R31_RS05115 (G6R31_05115) - 1021556..1021927 (-) 372 WP_017869220.1 helix-turn-helix transcriptional regulator -
  G6R31_RS05120 (G6R31_05120) - 1021924..1022643 (-) 720 WP_017869221.1 3'-5' exonuclease -
  G6R31_RS05125 (G6R31_05125) - 1022640..1023107 (-) 468 WP_017869222.1 hypothetical protein -
  G6R31_RS05130 (G6R31_05130) - 1023104..1023526 (-) 423 WP_017869223.1 hypothetical protein -
  G6R31_RS05135 (G6R31_05135) - 1023582..1023824 (-) 243 WP_017869224.1 hypothetical protein -
  G6R31_RS05140 (G6R31_05140) - 1023824..1024696 (-) 873 WP_152423437.1 N-6 DNA methylase -
  G6R31_RS05145 (G6R31_05145) - 1024693..1025091 (-) 399 WP_017869226.1 hypothetical protein -
  G6R31_RS05150 (G6R31_05150) - 1025088..1026032 (-) 945 WP_017869227.1 ATP-binding protein -
  G6R31_RS05155 (G6R31_05155) - 1026029..1026982 (-) 954 WP_152423438.1 hypothetical protein -
  G6R31_RS05160 (G6R31_05160) - 1026979..1027416 (-) 438 WP_017869229.1 hypothetical protein -
  G6R31_RS05165 (G6R31_05165) - 1027413..1028009 (-) 597 WP_017869230.1 hypothetical protein -
  G6R31_RS05170 (G6R31_05170) - 1027996..1028517 (-) 522 WP_152423439.1 HNH endonuclease -
  G6R31_RS16840 - 1028832..1029410 (-) 579 Protein_1013 Rad52/Rad22 family DNA repair protein -
  G6R31_RS05180 (G6R31_05180) - 1029498..1029845 (-) 348 WP_017869234.1 hypothetical protein -
  G6R31_RS05185 (G6R31_05185) - 1029842..1030300 (-) 459 WP_152423440.1 hypothetical protein -
  G6R31_RS05190 (G6R31_05190) - 1030538..1030789 (-) 252 WP_040383957.1 helix-turn-helix transcriptional regulator -
  G6R31_RS05195 (G6R31_05195) - 1030909..1031574 (+) 666 WP_161617816.1 helix-turn-helix domain-containing protein -
  G6R31_RS05200 (G6R31_05200) - 1031584..1032045 (+) 462 WP_017869238.1 S24 family peptidase -
  G6R31_RS05205 (G6R31_05205) - 1032150..1032644 (+) 495 WP_017869239.1 hypothetical protein -
  G6R31_RS05210 (G6R31_05210) - 1032670..1033194 (+) 525 WP_017869240.1 hypothetical protein -
  G6R31_RS05215 (G6R31_05215) - 1033203..1033703 (+) 501 WP_017869241.1 hypothetical protein -
  G6R31_RS05220 (G6R31_05220) - 1033779..1035194 (+) 1416 WP_081608180.1 recombinase family protein -
  G6R31_RS05225 (G6R31_05225) ychF 1035246..1036349 (+) 1104 WP_017869243.1 redox-regulated ATPase YchF -
  G6R31_RS05230 (G6R31_05230) - 1036427..1037524 (-) 1098 WP_025566572.1 N-acetylmuramoyl-L-alanine amidase -
  G6R31_RS05235 (G6R31_05235) - 1037990..1038643 (+) 654 WP_017872085.1 hypothetical protein -
  G6R31_RS05240 (G6R31_05240) - 1038679..1039515 (-) 837 WP_114671024.1 transposase -
  G6R31_RS05245 (G6R31_05245) comF 1039759..1040379 (+) 621 WP_017870400.1 ComF family protein Machinery gene
  G6R31_RS05250 (G6R31_05250) - 1040530..1041084 (-) 555 WP_025568116.1 DUF1684 domain-containing protein -
  G6R31_RS05255 (G6R31_05255) - 1041105..1041338 (-) 234 WP_017870402.1 RNA-binding S4 domain-containing protein -
  G6R31_RS05260 (G6R31_05260) - 1041428..1042363 (+) 936 WP_017870403.1 hypothetical protein -

Sequence

Protein


Download         Length: 206 a.a.        Molecular weight: 21619.12 Da        Isoelectric Point: 11.2140

>NTDB_id=426267 G6R31_RS05245 WP_017870400.1 1039759..1040379(+) (comF) [Deinococcus wulumuqiensis R12]
MLDLLRRLLPRPCPGCGEQLGRAAGLCTRCRAGLRPRTEQHSPLSPTPVPHLVTLGRYQGVLRRAVRALKYGGARDVAGA
LGSALAGGVPADWQVAAVVPVPLHSSRQRQRGYNQAELLAQAVAAELGVPCLPVLLRTRATAQQAKLHASERGANLAGAF
RVRGPLPTGTLLLVDDVLTTGHTLQACRDALSAAGAGDLKYAVVAR

Nucleotide


Download         Length: 621 bp        

>NTDB_id=426267 G6R31_RS05245 WP_017870400.1 1039759..1040379(+) (comF) [Deinococcus wulumuqiensis R12]
ATGCTCGACCTGTTGCGGCGCCTGCTCCCGCGCCCTTGCCCCGGTTGCGGCGAACAGCTGGGCCGCGCCGCCGGGCTGTG
CACCCGCTGCCGCGCCGGGCTGCGGCCCCGGACCGAGCAGCACTCGCCGCTGTCACCCACCCCCGTCCCGCATCTGGTCA
CGCTGGGACGCTATCAGGGCGTGCTCCGCCGGGCGGTCCGGGCGCTGAAATACGGCGGGGCGCGGGACGTGGCCGGGGCG
CTGGGCAGCGCTCTGGCGGGAGGTGTTCCGGCAGACTGGCAGGTGGCGGCAGTCGTGCCGGTGCCGCTGCATTCCTCGCG
TCAGCGGCAGCGCGGCTACAACCAGGCCGAACTGCTCGCGCAGGCCGTCGCCGCCGAGCTGGGGGTGCCCTGCCTGCCCG
TGCTGCTGCGCACCCGCGCCACCGCCCAGCAGGCCAAGTTGCACGCCAGCGAACGCGGCGCGAACCTGGCCGGGGCTTTC
AGGGTGCGCGGCCCGCTGCCAACGGGGACGCTTTTGCTGGTAGACGACGTGCTGACCACCGGACACACATTGCAGGCCTG
CCGCGACGCCCTCAGCGCCGCCGGAGCGGGCGACCTGAAATACGCCGTCGTCGCACGCTAG

Domains

Predicted by InterproScan.

Phosphoribosyl transferase domain (Pribosyltran)

(116-205)

Double zinc ribbon domain (DZR_2)

(4-40)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comF Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539

82.039

100

0.82
  comF Porphyromonas gingivalis W83

33.784

100

0.364