Detailed information
Bioinformatically predicted
Overview
| Name | comB3 | Type | Machinery gene |
| Locus tag | G3M69_RS00960 | Genome accession | NZ_CP048599 |
| Coordinates | 206068..206331 (-) | Length | 87 a.a. |
| NCBI ID | WP_001177716.1 | Uniprot ID | T0EUE0 |
| Organism | Helicobacter pylori strain GCT 97 | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 164767..217625 | 206068..206331 | within | 0 |
Gene organization within MGE regions
Location: 164767..217625
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G3M69_RS00805 (G3M69_00805) | - | 164767..165834 (+) | 1068 | WP_001120375.1 | tyrosine-type recombinase/integrase | - |
| G3M69_RS00810 (G3M69_00810) | - | 166151..166954 (-) | 804 | WP_021581690.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| G3M69_RS00815 (G3M69_00815) | - | 166926..167177 (-) | 252 | WP_078246108.1 | hypothetical protein | - |
| G3M69_RS08180 | - | 167309..167990 (-) | 682 | Protein_160 | CAAX protease | - |
| G3M69_RS00830 (G3M69_00830) | - | 168211..169224 (+) | 1014 | WP_163562742.1 | hypothetical protein | - |
| G3M69_RS00835 (G3M69_00835) | - | 169229..170506 (-) | 1278 | WP_163562743.1 | hypothetical protein | - |
| G3M69_RS00840 (G3M69_00840) | - | 170503..171765 (-) | 1263 | WP_163562744.1 | P-type conjugative transfer protein TrbL | - |
| G3M69_RS00845 (G3M69_00845) | - | 171762..173195 (-) | 1434 | WP_163562745.1 | hypothetical protein | - |
| G3M69_RS00850 (G3M69_00850) | - | 173205..175250 (-) | 2046 | WP_163562746.1 | hypothetical protein | - |
| G3M69_RS00855 (G3M69_00855) | - | 175250..176302 (-) | 1053 | WP_163562747.1 | ArdC family protein | - |
| G3M69_RS07825 | - | 176303..176467 (-) | 165 | WP_000189763.1 | hypothetical protein | - |
| G3M69_RS00860 (G3M69_00860) | - | 177105..177773 (+) | 669 | WP_001932455.1 | ParA family protein | - |
| G3M69_RS00865 (G3M69_00865) | - | 177820..178197 (+) | 378 | WP_000365707.1 | hypothetical protein | - |
| G3M69_RS00870 (G3M69_00870) | - | 178175..178840 (+) | 666 | WP_000855658.1 | hypothetical protein | - |
| G3M69_RS00875 (G3M69_00875) | - | 178914..179717 (-) | 804 | WP_000377497.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| G3M69_RS00880 (G3M69_00880) | - | 179687..180157 (-) | 471 | WP_000965788.1 | hypothetical protein | - |
| G3M69_RS00885 (G3M69_00885) | - | 180212..182272 (-) | 2061 | WP_163562748.1 | type IA DNA topoisomerase | - |
| G3M69_RS00890 (G3M69_00890) | - | 182285..182668 (-) | 384 | WP_001899672.1 | hypothetical protein | - |
| G3M69_RS00895 (G3M69_00895) | - | 182986..183195 (-) | 210 | WP_000462385.1 | hypothetical protein | - |
| G3M69_RS00900 (G3M69_00900) | - | 183316..189335 (-) | 6020 | Protein_176 | SNF2-related protein | - |
| G3M69_RS08185 | - | 189701..190510 (-) | 810 | WP_341534311.1 | helicase | - |
| G3M69_RS00905 (G3M69_00905) | - | 191944..194187 (-) | 2244 | WP_163562749.1 | type IV secretory system conjugative DNA transfer family protein | - |
| G3M69_RS00910 (G3M69_00910) | - | 194184..194702 (-) | 519 | WP_000760576.1 | hypothetical protein | - |
| G3M69_RS00915 (G3M69_00915) | - | 194699..195643 (-) | 945 | WP_000362459.1 | CpaF/VirB11 family protein | - |
| G3M69_RS00920 (G3M69_00920) | - | 195648..195923 (-) | 276 | WP_001278752.1 | hypothetical protein | - |
| G3M69_RS00925 (G3M69_00925) | - | 195940..196902 (-) | 963 | WP_163562750.1 | hypothetical protein | - |
| G3M69_RS00930 (G3M69_00930) | - | 196915..199137 (-) | 2223 | WP_163562751.1 | collagen-like protein | - |
| G3M69_RS00935 (G3M69_00935) | comB10 | 199121..200329 (-) | 1209 | WP_163562752.1 | DNA type IV secretion system protein ComB10 | Machinery gene |
| G3M69_RS00940 (G3M69_00940) | - | 200326..201981 (-) | 1656 | WP_163562753.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| G3M69_RS00945 (G3M69_00945) | - | 201978..203114 (-) | 1137 | WP_163562754.1 | VirB8/TrbF family protein | - |
| G3M69_RS07955 | - | 203107..203247 (-) | 141 | WP_000789926.1 | hypothetical protein | - |
| G3M69_RS00950 (G3M69_00950) | - | 203244..205820 (-) | 2577 | WP_163562755.1 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| G3M69_RS00955 (G3M69_00955) | - | 205820..206056 (-) | 237 | WP_108243306.1 | hypothetical protein | - |
| G3M69_RS00960 (G3M69_00960) | comB3 | 206068..206331 (-) | 264 | WP_001177716.1 | hypothetical protein | Machinery gene |
| G3M69_RS00965 (G3M69_00965) | - | 206343..206626 (-) | 284 | Protein_191 | TrbC/VirB2 family protein | - |
| G3M69_RS00970 (G3M69_00970) | - | 206614..207102 (-) | 489 | WP_163562756.1 | hypothetical protein | - |
| G3M69_RS00975 (G3M69_00975) | - | 207095..207325 (-) | 231 | WP_000189078.1 | hypothetical protein | - |
| G3M69_RS00980 (G3M69_00980) | - | 207328..208116 (-) | 789 | WP_205424853.1 | integrase | - |
| G3M69_RS08125 (G3M69_00985) | - | 208170..208349 (-) | 180 | Protein_195 | metal-dependent hydrolase | - |
| G3M69_RS08130 (G3M69_00990) | - | 208346..209479 (-) | 1134 | WP_163562757.1 | sulfatase-like hydrolase/transferase | - |
| G3M69_RS00995 (G3M69_00995) | - | 209682..210539 (-) | 858 | WP_000657593.1 | cytochrome c1 | - |
| G3M69_RS01000 (G3M69_01000) | - | 210536..211774 (-) | 1239 | WP_000807885.1 | cytochrome bc complex cytochrome b subunit | - |
| G3M69_RS01005 (G3M69_01005) | - | 211785..212288 (-) | 504 | WP_000763659.1 | ubiquinol-cytochrome c reductase iron-sulfur subunit | - |
| G3M69_RS01010 (G3M69_01010) | mfd | 212413..215418 (-) | 3006 | WP_163562758.1 | transcription-repair coupling factor | - |
| G3M69_RS01015 (G3M69_01015) | - | 215422..215736 (-) | 315 | WP_000384498.1 | polymer-forming cytoskeletal protein | - |
| G3M69_RS01020 (G3M69_01020) | csd1 | 215751..216689 (-) | 939 | WP_000478115.1 | peptidoglycan DD-metalloendopeptidase Csd1 | - |
| G3M69_RS01025 (G3M69_01025) | csd2 | 216699..217625 (-) | 927 | WP_163562759.1 | M23B family cell shape-determining DD-metalloendopeptidase Csd2 | - |
Sequence
Protein
Download Length: 87 a.a. Molecular weight: 9970.83 Da Isoelectric Point: 5.7206
>NTDB_id=421664 G3M69_RS00960 WP_001177716.1 206068..206331(-) (comB3) [Helicobacter pylori strain GCT 97]
MQLVGISVSNLKEISSKEKFLWLNAKSFLLSGFVPFIMIPWLDILNSFVLYVCFLLIFSIAEFFDEDISDILIAHSKIKT
KANSFYA
MQLVGISVSNLKEISSKEKFLWLNAKSFLLSGFVPFIMIPWLDILNSFVLYVCFLLIFSIAEFFDEDISDILIAHSKIKT
KANSFYA
Nucleotide
Download Length: 264 bp
>NTDB_id=421664 G3M69_RS00960 WP_001177716.1 206068..206331(-) (comB3) [Helicobacter pylori strain GCT 97]
ATGCAATTAGTTGGTATTTCAGTTTCTAATCTCAAAGAAATCAGCTCCAAAGAAAAATTTCTTTGGCTCAATGCTAAGAG
TTTTTTACTCTCAGGATTTGTGCCTTTTATTATGATACCTTGGCTAGATATATTGAACTCTTTTGTGCTTTATGTGTGCT
TTCTCTTAATTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGTGACATTTTAATCGCTCATTCCAAAATTAAAACC
AAAGCTAATTCATTTTACGCTTAA
ATGCAATTAGTTGGTATTTCAGTTTCTAATCTCAAAGAAATCAGCTCCAAAGAAAAATTTCTTTGGCTCAATGCTAAGAG
TTTTTTACTCTCAGGATTTGTGCCTTTTATTATGATACCTTGGCTAGATATATTGAACTCTTTTGTGCTTTATGTGTGCT
TTCTCTTAATTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGTGACATTTTAATCGCTCATTCCAAAATTAAAACC
AAAGCTAATTCATTTTACGCTTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB3 | Helicobacter pylori 26695 |
60.92 |
100 |
0.609 |