Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   H8S71_RS12105 Genome accession   NZ_CP060417
Coordinates   2380025..2380408 (-) Length   127 a.a.
NCBI ID   WP_029317913.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain ONU 559     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2375025..2385408
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H8S71_RS12065 (H8S71_12060) sinI 2375958..2376131 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  H8S71_RS12070 (H8S71_12065) sinR 2376165..2376500 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  H8S71_RS12075 (H8S71_12070) tasA 2376593..2377378 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  H8S71_RS12080 (H8S71_12075) sipW 2377442..2378014 (-) 573 WP_128993656.1 signal peptidase I SipW -
  H8S71_RS12085 (H8S71_12080) tapA 2377998..2378759 (-) 762 WP_128993152.1 amyloid fiber anchoring/assembly protein TapA -
  H8S71_RS12090 (H8S71_12085) yqzG 2379031..2379357 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  H8S71_RS12095 (H8S71_12090) spoIITA 2379399..2379578 (-) 180 WP_014480252.1 YqzE family protein -
  H8S71_RS12100 (H8S71_12095) comGG 2379650..2380024 (-) 375 WP_128993153.1 ComG operon protein ComGG Machinery gene
  H8S71_RS12105 (H8S71_12100) comGF 2380025..2380408 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  H8S71_RS12110 (H8S71_12105) comGE 2380434..2380781 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  H8S71_RS12115 (H8S71_12110) comGD 2380765..2381196 (-) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  H8S71_RS12120 (H8S71_12115) comGC 2381186..2381482 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  H8S71_RS12125 (H8S71_12120) comGB 2381496..2382533 (-) 1038 WP_072175548.1 comG operon protein ComGB Machinery gene
  H8S71_RS12130 (H8S71_12125) comGA 2382520..2383590 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  H8S71_RS12135 (H8S71_12130) corA 2384002..2384955 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14363.43 Da        Isoelectric Point: 5.8949

>NTDB_id=415065 H8S71_RS12105 WP_029317913.1 2380025..2380408(-) (comGF) [Bacillus subtilis subsp. subtilis strain ONU 559]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=415065 H8S71_RS12105 WP_029317913.1 2380025..2380408(-) (comGF) [Bacillus subtilis subsp. subtilis strain ONU 559]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGATATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976