Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   BABF1_RS18580 Genome accession   NZ_CP047131
Coordinates   3627903..3628682 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus anthracis str. BF1     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3593582..3667507 3627903..3628682 within 0


Gene organization within MGE regions


Location: 3593582..3667507
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BABF1_RS18430 (BABF1_018430) - 3593925..3595595 (-) 1671 WP_000823085.1 ribonuclease J -
  BABF1_RS18435 (BABF1_018435) dapA 3596361..3597239 (-) 879 WP_000564767.1 4-hydroxy-tetrahydrodipicolinate synthase -
  BABF1_RS18440 (BABF1_018440) dapG 3597251..3598483 (-) 1233 WP_000692470.1 aspartate kinase -
  BABF1_RS18445 (BABF1_018445) asd 3598507..3599553 (-) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  BABF1_RS18450 (BABF1_018450) dpaB 3599704..3600303 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  BABF1_RS18455 (BABF1_018455) dpaA 3600300..3601202 (-) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  BABF1_RS18460 (BABF1_018460) - 3601477..3601728 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  BABF1_RS18465 (BABF1_018465) - 3601855..3603096 (-) 1242 WP_000592993.1 M16 family metallopeptidase -
  BABF1_RS18470 (BABF1_018470) - 3603183..3604082 (-) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  BABF1_RS18475 (BABF1_018475) pnp 3604233..3606371 (-) 2139 WP_000076750.1 polyribonucleotide nucleotidyltransferase -
  BABF1_RS18480 (BABF1_018480) rpsO 3606532..3606801 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  BABF1_RS18485 (BABF1_018485) ribF 3606902..3607873 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  BABF1_RS18490 (BABF1_018490) truB 3607917..3608840 (-) 924 WP_000399357.1 tRNA pseudouridine(55) synthase TruB -
  BABF1_RS18495 (BABF1_018495) rbfA 3608927..3609283 (-) 357 WP_000776441.1 30S ribosome-binding factor RbfA -
  BABF1_RS18500 (BABF1_018500) - 3609299..3609580 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  BABF1_RS18505 (BABF1_018505) infB 3609577..3611637 (-) 2061 WP_000036340.1 translation initiation factor IF-2 -
  BABF1_RS18510 (BABF1_018510) - 3611642..3611953 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  BABF1_RS18515 (BABF1_018515) rnpM 3611954..3612226 (-) 273 WP_000071128.1 RNase P modulator RnpM -
  BABF1_RS18520 (BABF1_018520) nusA 3612238..3613344 (-) 1107 WP_000102606.1 transcription termination factor NusA -
  BABF1_RS18525 (BABF1_018525) rimP 3613362..3613832 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  BABF1_RS18530 (BABF1_018530) - 3614165..3618466 (-) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  BABF1_RS18535 (BABF1_018535) - 3618591..3620291 (-) 1701 WP_000814312.1 proline--tRNA ligase -
  BABF1_RS18540 (BABF1_018540) rseP 3620401..3621657 (-) 1257 WP_001090228.1 RIP metalloprotease RseP -
  BABF1_RS18545 (BABF1_018545) dxr 3621674..3622816 (-) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  BABF1_RS18550 (BABF1_018550) cdsA 3622840..3623631 (-) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  BABF1_RS18555 (BABF1_018555) uppS 3623649..3624425 (-) 777 WP_000971301.1 isoprenyl transferase -
  BABF1_RS18560 (BABF1_018560) frr 3624511..3625068 (-) 558 WP_000531503.1 ribosome recycling factor -
  BABF1_RS18565 (BABF1_018565) pyrH 3625071..3625793 (-) 723 WP_000042663.1 UMP kinase -
  BABF1_RS18570 (BABF1_018570) tsf 3625860..3626747 (-) 888 WP_001018581.1 translation elongation factor Ts -
  BABF1_RS18575 (BABF1_018575) rpsB 3626851..3627552 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  BABF1_RS18580 (BABF1_018580) codY 3627903..3628682 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  BABF1_RS18585 (BABF1_018585) hslU 3628760..3630151 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  BABF1_RS18590 (BABF1_018590) hslV 3630174..3630716 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  BABF1_RS18595 (BABF1_018595) xerC 3630759..3631658 (-) 900 WP_001101226.1 tyrosine recombinase XerC -
  BABF1_RS18600 (BABF1_018600) trmFO 3631724..3633028 (-) 1305 WP_001991958.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  BABF1_RS18605 (BABF1_018605) topA 3633079..3635157 (-) 2079 WP_001286969.1 type I DNA topoisomerase -
  BABF1_RS18610 (BABF1_018610) dprA 3635302..3636050 (-) 749 Protein_3689 DNA-processing protein DprA -
  BABF1_RS18615 (BABF1_018615) sucD 3636258..3637160 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  BABF1_RS18620 (BABF1_018620) sucC 3637181..3638341 (-) 1161 WP_001020786.1 ADP-forming succinate--CoA ligase subunit beta -
  BABF1_RS18625 (BABF1_018625) rnhB 3638536..3639309 (-) 774 WP_001174712.1 ribonuclease HII -
  BABF1_RS18630 (BABF1_018630) ylqF 3639361..3640251 (-) 891 WP_000236707.1 ribosome biogenesis GTPase YlqF -
  BABF1_RS18635 (BABF1_018635) lepB 3640272..3640823 (-) 552 WP_000711857.1 signal peptidase I -
  BABF1_RS18640 (BABF1_018640) rplS 3640925..3641269 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  BABF1_RS18645 (BABF1_018645) trmD 3641416..3642150 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  BABF1_RS18650 (BABF1_018650) rimM 3642150..3642665 (-) 516 WP_000170269.1 ribosome maturation factor RimM -
  BABF1_RS18655 (BABF1_018655) - 3642786..3643013 (-) 228 WP_000737398.1 KH domain-containing protein -
  BABF1_RS18660 (BABF1_018660) rpsP 3643028..3643300 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  BABF1_RS18665 (BABF1_018665) ffh 3643401..3644750 (-) 1350 WP_000863456.1 signal recognition particle protein -
  BABF1_RS18670 (BABF1_018670) - 3644763..3645095 (-) 333 WP_000891062.1 putative DNA-binding protein -
  BABF1_RS18675 (BABF1_018675) ftsY 3645229..3646218 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  BABF1_RS18680 (BABF1_018680) smc 3646234..3649803 (-) 3570 WP_000478986.1 chromosome segregation protein SMC -
  BABF1_RS18685 (BABF1_018685) rncS 3649950..3650687 (-) 738 WP_001146873.1 ribonuclease III -
  BABF1_RS18690 (BABF1_018690) acpP 3650746..3650979 (-) 234 WP_000786062.1 acyl carrier protein -
  BABF1_RS18695 (BABF1_018695) fabG 3651049..3651789 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  BABF1_RS18700 (BABF1_018700) fabD 3651789..3652733 (-) 945 WP_000516957.1 ACP S-malonyltransferase -
  BABF1_RS18705 (BABF1_018705) plsX 3652748..3653740 (-) 993 WP_000684111.1 phosphate acyltransferase PlsX -
  BABF1_RS18710 (BABF1_018710) fapR 3653737..3654330 (-) 594 WP_000747352.1 transcription factor FapR -
  BABF1_RS18715 (BABF1_018715) recG 3654419..3656467 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  BABF1_RS18720 (BABF1_018720) - 3656757..3658433 (-) 1677 WP_000027140.1 DAK2 domain-containing protein -
  BABF1_RS18725 (BABF1_018725) - 3658456..3658818 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  BABF1_RS18730 (BABF1_018730) rpmB 3659197..3659385 (+) 189 WP_000124778.1 50S ribosomal protein L28 -
  BABF1_RS18735 (BABF1_018735) spoVM 3659459..3659539 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  BABF1_RS18740 (BABF1_018740) - 3659606..3660286 (-) 681 WP_025388434.1 thiamine diphosphokinase -
  BABF1_RS18745 (BABF1_018745) rpe 3660386..3661030 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  BABF1_RS18750 (BABF1_018750) rsgA 3661033..3661914 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  BABF1_RS18755 (BABF1_018755) prkC 3662183..3664156 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  BABF1_RS18760 (BABF1_018760) - 3664165..3664917 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  BABF1_RS18765 (BABF1_018765) rlmN 3664922..3666010 (-) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  BABF1_RS18770 (BABF1_018770) rsmB 3666015..3667349 (-) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=410876 BABF1_RS18580 WP_000421288.1 3627903..3628682(-) (codY) [Bacillus anthracis str. BF1]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=410876 BABF1_RS18580 WP_000421288.1 3627903..3628682(-) (codY) [Bacillus anthracis str. BF1]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459


Multiple sequence alignment