Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   FOC08_RS20435 Genome accession   NZ_CP047099
Coordinates   4020756..4021535 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus anthracis strain FDAARGOS_700     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3986434..4060357 4020756..4021535 within 0


Gene organization within MGE regions


Location: 3986434..4060357
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FOC08_RS20285 (FOC08_20290) - 3986778..3988448 (-) 1671 WP_000823085.1 ribonuclease J -
  FOC08_RS20290 (FOC08_20295) dapA 3989214..3990092 (-) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  FOC08_RS20295 (FOC08_20300) dapG 3990104..3991336 (-) 1233 WP_000692470.1 aspartate kinase -
  FOC08_RS20300 (FOC08_20305) asd 3991360..3992406 (-) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  FOC08_RS20305 (FOC08_20310) dpaB 3992557..3993156 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  FOC08_RS20310 (FOC08_20315) dpaA 3993153..3994055 (-) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  FOC08_RS20315 (FOC08_20320) - 3994330..3994581 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  FOC08_RS20320 (FOC08_20325) - 3994708..3995949 (-) 1242 WP_000592993.1 pitrilysin family protein -
  FOC08_RS20325 (FOC08_20330) - 3996036..3996935 (-) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  FOC08_RS20330 (FOC08_20335) pnp 3997087..3999225 (-) 2139 WP_000076733.1 polyribonucleotide nucleotidyltransferase -
  FOC08_RS20335 (FOC08_20340) rpsO 3999386..3999655 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  FOC08_RS20340 (FOC08_20345) ribF 3999756..4000727 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  FOC08_RS20345 (FOC08_20350) truB 4000771..4001694 (-) 924 WP_000399357.1 tRNA pseudouridine(55) synthase TruB -
  FOC08_RS20350 (FOC08_20355) rbfA 4001781..4002137 (-) 357 WP_000776446.1 30S ribosome-binding factor RbfA -
  FOC08_RS20355 (FOC08_20360) - 4002153..4002434 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  FOC08_RS20360 (FOC08_20365) infB 4002431..4004491 (-) 2061 WP_000036339.1 translation initiation factor IF-2 -
  FOC08_RS20365 (FOC08_20370) - 4004496..4004807 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  FOC08_RS20370 (FOC08_20375) rnpM 4004808..4005080 (-) 273 WP_000071128.1 RNase P modulator RnpM -
  FOC08_RS20375 (FOC08_20380) nusA 4005092..4006198 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  FOC08_RS20380 (FOC08_20385) rimP 4006216..4006686 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  FOC08_RS20385 (FOC08_20390) - 4007019..4011320 (-) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  FOC08_RS20390 (FOC08_20395) - 4011445..4013145 (-) 1701 WP_000814312.1 proline--tRNA ligase -
  FOC08_RS20395 (FOC08_20400) rseP 4013255..4014511 (-) 1257 WP_001090228.1 RIP metalloprotease RseP -
  FOC08_RS20400 (FOC08_20405) dxr 4014528..4015670 (-) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  FOC08_RS20405 (FOC08_20410) cdsA 4015694..4016485 (-) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  FOC08_RS20410 (FOC08_20415) uppS 4016503..4017279 (-) 777 WP_000971303.1 isoprenyl transferase -
  FOC08_RS20415 (FOC08_20420) frr 4017365..4017922 (-) 558 WP_000531498.1 ribosome recycling factor -
  FOC08_RS20420 (FOC08_20425) pyrH 4017925..4018647 (-) 723 WP_000042663.1 UMP kinase -
  FOC08_RS20425 (FOC08_20430) tsf 4018714..4019601 (-) 888 WP_001018581.1 translation elongation factor Ts -
  FOC08_RS20430 (FOC08_20435) rpsB 4019705..4020406 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  FOC08_RS20435 (FOC08_20440) codY 4020756..4021535 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  FOC08_RS20440 (FOC08_20445) hslU 4021613..4023004 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  FOC08_RS20445 (FOC08_20450) hslV 4023027..4023569 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  FOC08_RS20450 (FOC08_20455) xerC 4023612..4024511 (-) 900 WP_001101226.1 tyrosine recombinase XerC -
  FOC08_RS20455 (FOC08_20460) trmFO 4024577..4025881 (-) 1305 WP_003161605.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  FOC08_RS20460 (FOC08_20465) topA 4025932..4028010 (-) 2079 WP_001286969.1 type I DNA topoisomerase -
  FOC08_RS20465 (FOC08_20470) dprA 4028155..4028903 (-) 749 Protein_4056 DNA-processing protein DprA -
  FOC08_RS20470 (FOC08_20475) sucD 4029111..4030013 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  FOC08_RS20475 (FOC08_20480) sucC 4030034..4031194 (-) 1161 WP_001020786.1 ADP-forming succinate--CoA ligase subunit beta -
  FOC08_RS20480 (FOC08_20485) rnhB 4031388..4032161 (-) 774 WP_001174712.1 ribonuclease HII -
  FOC08_RS20485 (FOC08_20490) ylqF 4032213..4033103 (-) 891 WP_000236707.1 ribosome biogenesis GTPase YlqF -
  FOC08_RS20490 (FOC08_20495) lepB 4033124..4033675 (-) 552 WP_000711857.1 signal peptidase I -
  FOC08_RS20495 (FOC08_20500) rplS 4033777..4034121 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  FOC08_RS20500 (FOC08_20505) trmD 4034268..4035002 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  FOC08_RS20505 (FOC08_20510) rimM 4035002..4035517 (-) 516 WP_000170269.1 ribosome maturation factor RimM -
  FOC08_RS20510 (FOC08_20515) - 4035638..4035865 (-) 228 WP_000737398.1 KH domain-containing protein -
  FOC08_RS20515 (FOC08_20520) rpsP 4035880..4036152 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  FOC08_RS20520 (FOC08_20525) ffh 4036253..4037602 (-) 1350 WP_000863456.1 signal recognition particle protein -
  FOC08_RS20525 (FOC08_20530) - 4037615..4037947 (-) 333 WP_000891062.1 putative DNA-binding protein -
  FOC08_RS20530 (FOC08_20535) ftsY 4038080..4039069 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  FOC08_RS20535 (FOC08_20540) smc 4039085..4042654 (-) 3570 WP_000478985.1 chromosome segregation protein SMC -
  FOC08_RS20540 (FOC08_20545) rncS 4042801..4043538 (-) 738 WP_001146873.1 ribonuclease III -
  FOC08_RS20545 (FOC08_20550) acpP 4043597..4043830 (-) 234 WP_000786062.1 acyl carrier protein -
  FOC08_RS20550 (FOC08_20555) fabG 4043900..4044640 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  FOC08_RS20555 (FOC08_20560) fabD 4044640..4045584 (-) 945 WP_000516958.1 ACP S-malonyltransferase -
  FOC08_RS20560 (FOC08_20565) plsX 4045599..4046591 (-) 993 WP_000684111.1 phosphate acyltransferase PlsX -
  FOC08_RS20565 (FOC08_20570) fapR 4046588..4047181 (-) 594 WP_000747352.1 transcription factor FapR -
  FOC08_RS20570 (FOC08_20575) recG 4047270..4049318 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  FOC08_RS20575 (FOC08_20580) - 4049608..4051284 (-) 1677 WP_000027136.1 DAK2 domain-containing protein -
  FOC08_RS20580 (FOC08_20585) - 4051307..4051669 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  FOC08_RS20585 (FOC08_20590) rpmB 4052048..4052236 (+) 189 WP_000124778.1 50S ribosomal protein L28 -
  FOC08_RS20590 (FOC08_20595) spoVM 4052309..4052389 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  FOC08_RS20595 (FOC08_20600) - 4052456..4053136 (-) 681 WP_025388434.1 thiamine diphosphokinase -
  FOC08_RS20600 (FOC08_20605) rpe 4053236..4053880 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  FOC08_RS20605 (FOC08_20610) rsgA 4053883..4054764 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  FOC08_RS20610 (FOC08_20615) prkC 4055033..4057006 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  FOC08_RS20615 (FOC08_20620) - 4057015..4057767 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  FOC08_RS20620 (FOC08_20625) rlmN 4057772..4058860 (-) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  FOC08_RS20625 (FOC08_20630) rsmB 4058865..4060199 (-) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=410429 FOC08_RS20435 WP_000421288.1 4020756..4021535(-) (codY) [Bacillus anthracis strain FDAARGOS_700]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=410429 FOC08_RS20435 WP_000421288.1 4020756..4021535(-) (codY) [Bacillus anthracis strain FDAARGOS_700]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459

Multiple sequence alignment