Detailed information    

experimental Experimentally validated

Overview


Name   SMU.769   Type   Unclear
Locus tag   SMU_RS03580 Genome accession   NC_004350
Coordinates   716931..717143 (+) Length   70 a.a.
NCBI ID   WP_002261923.1    Uniprot ID   Q8DUX2
Organism   Streptococcus mutans UA159     
Function   require for competence   
Unclear

Function


Deletion of SMU.769 reduced chromosomal transformation 2.3-fold. SMU.769 belongs to a family of conserved genes induced by the competence-stimulating peptide and which have no established function.


Genomic Context


Location: 711931..722143
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SMU_RS03560 (SMU.764) ahpC 712912..713472 (+) 561 WP_002263620.1 alkyl hydroperoxide reductase subunit C -
  SMU_RS03565 (SMU.765) ahpF 713482..715014 (+) 1533 WP_002263619.1 alkyl hydroperoxide reductase subunit F -
  SMU_RS03570 - 715085..716433 (+) 1349 WP_086956939.1 IS3-like element ISSmu1 family transposase -
  SMU_RS03575 (SMU.768c) - 716480..716797 (-) 318 WP_002261922.1 hypothetical protein -
  SMU_RS03580 (SMU.769) SMU.769 716931..717143 (+) 213 WP_002261923.1 YdbC family protein Unclear
  SMU_RS03585 (SMU.770c) - 717333..718673 (-) 1341 WP_002261924.1 Nramp family divalent metal transporter -
  SMU_RS10125 (SMU.771c) - 719213..719347 (-) 135 WP_002261925.1 hypothetical protein -
  SMU_RS03590 (SMU.772) - 719789..721969 (+) 2181 WP_002261926.1 YSIRK-type signal peptide-containing protein -

Sequence


Protein


Download         Length: 70 a.a.        Molecular weight: 8124.19 Da        Isoelectric Point: 4.7954

>NTDB_id=410 SMU_RS03580 WP_002261923.1 716931..717143(+) (SMU.769) [Streptococcus mutans UA159]
MAEFTFEIEEKLLVLSENDKGWTKELNRVSFNGAPAKYDIRSWSPDHTKMGKGITLTNEEFDVLVNEFKK

Nucleotide


Download         Length: 213 bp        

>NTDB_id=410 SMU_RS03580 WP_002261923.1 716931..717143(+) (SMU.769) [Streptococcus mutans UA159]
ATGGCAGAATTTACATTTGAAATTGAAGAAAAACTTTTGGTCTTATCCGAAAACGATAAGGGTTGGACTAAAGAACTTAA
TCGCGTTAGTTTTAATGGCGCTCCAGCAAAATATGATATTCGCTCTTGGAGCCCCGACCATACCAAAATGGGTAAGGGTA
TTACACTGACGAATGAAGAATTTGATGTCTTAGTCAATGAATTTAAAAAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8DUX2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] R E Eaton et al. (2010) Deletion of competence-induced genes over-expressed in biofilms caused transformation deficiencies in Streptococcus mutans. Molecular Oral Microbiology 25(6):406-17. [PMID: 21040514]