Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   HWV68_RS13330 Genome accession   NZ_CP058242
Coordinates   2556517..2556900 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   P25958
Organism   Bacillus subtilis strain SP1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2551517..2561900
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HWV68_RS13290 (HWV68_13285) sinI 2552451..2552624 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  HWV68_RS13295 (HWV68_13290) sinR 2552658..2552993 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  HWV68_RS13300 (HWV68_13295) tasA 2553086..2553871 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  HWV68_RS13305 (HWV68_13300) sipW 2553935..2554507 (-) 573 WP_003246088.1 signal peptidase I SipW -
  HWV68_RS13310 (HWV68_13305) tapA 2554491..2555252 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  HWV68_RS13315 (HWV68_13310) yqzG 2555524..2555850 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  HWV68_RS13320 (HWV68_13315) spoIITA 2555892..2556071 (-) 180 WP_003230176.1 YqzE family protein -
  HWV68_RS13325 (HWV68_13320) comGG 2556142..2556516 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  HWV68_RS13330 (HWV68_13325) comGF 2556517..2556900 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  HWV68_RS13335 (HWV68_13330) comGE 2556926..2557273 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  HWV68_RS13340 (HWV68_13335) comGD 2557257..2557688 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  HWV68_RS13345 (HWV68_13340) comGC 2557678..2557974 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  HWV68_RS13350 (HWV68_13345) comGB 2557988..2559025 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  HWV68_RS13355 (HWV68_13350) comGA 2559012..2560082 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  HWV68_RS13360 (HWV68_13355) corA 2560494..2561447 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=404091 HWV68_RS13330 WP_003230168.1 2556517..2556900(-) (comGF) [Bacillus subtilis strain SP1]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=404091 HWV68_RS13330 WP_003230168.1 2556517..2556900(-) (comGF) [Bacillus subtilis strain SP1]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25958

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment