Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   SSAL_RS00740 Genome accession   NC_017594
Coordinates   138256..138486 (+) Length   76 a.a.
NCBI ID   WP_013991265.1    Uniprot ID   -
Organism   Streptococcus salivarius 57.I     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 133256..143486
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SSAL_RS00715 (Ssal_00141) - 135149..135511 (+) 363 WP_002887019.1 DUF1033 family protein -
  SSAL_RS00720 (Ssal_00142) comGA/cglA/cilD 135590..136531 (+) 942 WP_002887018.1 competence type IV pilus ATPase ComGA Machinery gene
  SSAL_RS00725 (Ssal_00143) comGB 136413..137513 (+) 1101 WP_118172207.1 competence type IV pilus assembly protein ComGB Machinery gene
  SSAL_RS00730 (Ssal_00144) comGC 137522..137836 (+) 315 WP_037611125.1 competence type IV pilus major pilin ComGC Machinery gene
  SSAL_RS00735 (Ssal_00145) comGD 137796..138224 (+) 429 WP_014632541.1 competence type IV pilus minor pilin ComGD Machinery gene
  SSAL_RS00740 (Ssal_00146) comGE 138256..138486 (+) 231 WP_013991265.1 competence type IV pilus minor pilin ComGE Machinery gene
  SSAL_RS00745 (Ssal_00147) comGF 138473..138910 (+) 438 WP_014632542.1 competence type IV pilus minor pilin ComGF Machinery gene
  SSAL_RS00750 comGG 138888..139205 (+) 318 WP_045001363.1 competence type IV pilus minor pilin ComGG Machinery gene
  SSAL_RS00755 (Ssal_00149) comGH 139250..140206 (+) 957 WP_014632544.1 class I SAM-dependent methyltransferase Machinery gene
  SSAL_RS00760 (Ssal_00150) - 140263..141456 (+) 1194 WP_045001366.1 acetate kinase -
  SSAL_RS00765 (Ssal_00151) - 141707..141904 (+) 198 WP_002885716.1 helix-turn-helix transcriptional regulator -
  SSAL_RS00770 (Ssal_00152) - 141916..142572 (+) 657 WP_014632546.1 type II CAAX endopeptidase family protein -
  SSAL_RS00775 (Ssal_00153) - 142650..143096 (+) 447 WP_045001368.1 hypothetical protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8399.82 Da        Isoelectric Point: 10.4655

>NTDB_id=40130 SSAL_RS00740 WP_013991265.1 138256..138486(+) (comGE) [Streptococcus salivarius 57.I]
MAVLVLVSGLILDQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSKQGIAVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=40130 SSAL_RS00740 WP_013991265.1 138256..138486(+) (comGE) [Streptococcus salivarius 57.I]
ATGGCTGTCTTAGTACTCGTCAGTGGTCTTATCTTGGATCAGATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTTTTGAGTGTGGCAACCATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGCATCACAGTGA
CAGTAAAACGTAGCAAGCAAGGTATCGCGGTTTACGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

37.838

97.368

0.368

  comGE Streptococcus mutans UA159

37.838

97.368

0.368


Multiple sequence alignment