Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   HRE60_RS08950 Genome accession   NZ_CP054153
Coordinates   1968219..1968449 (-) Length   76 a.a.
NCBI ID   WP_021144685.1    Uniprot ID   -
Organism   Streptococcus salivarius strain DB-B5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1963219..1973449
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HRE60_RS08915 (HRE60_08915) - 1963608..1964054 (-) 447 WP_181670750.1 CAAX protease -
  HRE60_RS08920 (HRE60_08920) - 1964132..1964788 (-) 657 WP_073687812.1 type II CAAX endopeptidase family protein -
  HRE60_RS08925 (HRE60_08925) - 1964800..1964997 (-) 198 WP_084870139.1 helix-turn-helix transcriptional regulator -
  HRE60_RS08930 (HRE60_08930) - 1965249..1966442 (-) 1194 WP_002885831.1 acetate kinase -
  HRE60_RS08935 (HRE60_08935) comGH 1966499..1967455 (-) 957 WP_002885753.1 class I SAM-dependent methyltransferase Machinery gene
  HRE60_RS08940 (HRE60_08940) comGG 1967500..1967817 (-) 318 WP_037605448.1 competence type IV pilus minor pilin ComGG Machinery gene
  HRE60_RS08945 (HRE60_08945) comGF 1967795..1968232 (-) 438 WP_181670751.1 competence type IV pilus minor pilin ComGF Machinery gene
  HRE60_RS08950 (HRE60_08950) comGE 1968219..1968449 (-) 231 WP_021144685.1 competence type IV pilus minor pilin ComGE Machinery gene
  HRE60_RS08955 (HRE60_08955) comGD 1968481..1968909 (-) 429 WP_014632541.1 competence type IV pilus minor pilin ComGD Machinery gene
  HRE60_RS08960 (HRE60_08960) comGC 1968869..1969183 (-) 315 WP_037611125.1 competence type IV pilus major pilin ComGC Machinery gene
  HRE60_RS08965 (HRE60_08965) comGB 1969192..1970292 (-) 1101 WP_181670752.1 competence type IV pilus assembly protein ComGB Machinery gene
  HRE60_RS08970 (HRE60_08970) comGA 1970174..1971115 (-) 942 WP_181670753.1 competence type IV pilus ATPase ComGA Machinery gene
  HRE60_RS08975 (HRE60_08975) - 1971195..1971557 (-) 363 WP_002887019.1 DUF1033 family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8413.85 Da        Isoelectric Point: 10.4655

>NTDB_id=397570 HRE60_RS08950 WP_021144685.1 1968219..1968449(-) (comGE) [Streptococcus salivarius strain DB-B5]
MAVLVLVSGLILEQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSKQGIAVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=397570 HRE60_RS08950 WP_021144685.1 1968219..1968449(-) (comGE) [Streptococcus salivarius strain DB-B5]
ATGGCTGTTTTAGTACTTGTCAGTGGTCTTATTTTGGAACAAATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCAACCATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGCATCACAGTGA
CAGTTAAACGTAGCAAGCAAGGTATCGCGGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

37.838

97.368

0.368

  comGE Streptococcus mutans UA159

37.838

97.368

0.368