Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   GII89_RS13340 Genome accession   NZ_CP045812
Coordinates   2556096..2556479 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain P8_B3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2551096..2561479
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII89_RS13300 (GII89_13300) sinI 2552030..2552203 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII89_RS13305 (GII89_13305) sinR 2552237..2552572 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII89_RS13310 (GII89_13310) tasA 2552665..2553450 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  GII89_RS13315 (GII89_13315) sipW 2553514..2554086 (-) 573 WP_003246088.1 signal peptidase I SipW -
  GII89_RS13320 (GII89_13320) tapA 2554070..2554831 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  GII89_RS13325 (GII89_13325) yqzG 2555103..2555429 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII89_RS13330 (GII89_13330) spoIITA 2555471..2555650 (-) 180 WP_003230176.1 YqzE family protein -
  GII89_RS13335 (GII89_13335) comGG 2555721..2556095 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  GII89_RS13340 (GII89_13340) comGF 2556096..2556479 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  GII89_RS13345 (GII89_13345) comGE 2556505..2556852 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  GII89_RS13350 (GII89_13350) comGD 2556836..2557267 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  GII89_RS13355 (GII89_13355) comGC 2557257..2557553 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  GII89_RS13360 (GII89_13360) comGB 2557567..2558604 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  GII89_RS13365 (GII89_13365) comGA 2558591..2559661 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  GII89_RS13370 (GII89_13370) corA 2560073..2561026 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=397511 GII89_RS13340 WP_003230168.1 2556096..2556479(-) (comGF) [Bacillus subtilis strain P8_B3]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=397511 GII89_RS13340 WP_003230168.1 2556096..2556479(-) (comGF) [Bacillus subtilis strain P8_B3]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment