Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   FOC73_RS04700 Genome accession   NZ_CP053998
Coordinates   990133..990363 (-) Length   76 a.a.
NCBI ID   WP_002885825.1    Uniprot ID   -
Organism   Streptococcus salivarius strain FDAARGOS_771     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 985133..995363
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FOC73_RS04665 (FOC73_04665) - 985523..985969 (-) 447 WP_002885743.1 hypothetical protein -
  FOC73_RS04670 (FOC73_04670) - 986047..986703 (-) 657 WP_002885876.1 CPBP family intramembrane glutamic endopeptidase -
  FOC73_RS04675 (FOC73_04675) - 986715..986912 (-) 198 WP_002885716.1 helix-turn-helix transcriptional regulator -
  FOC73_RS04680 (FOC73_04680) - 987163..988356 (-) 1194 WP_002885831.1 acetate kinase -
  FOC73_RS04685 (FOC73_04685) comGH 988413..989369 (-) 957 WP_002885753.1 class I SAM-dependent methyltransferase Machinery gene
  FOC73_RS04690 (FOC73_04690) comGG 989414..989731 (-) 318 WP_037605448.1 competence type IV pilus minor pilin ComGG Machinery gene
  FOC73_RS04695 (FOC73_04695) comGF 989709..990146 (-) 438 WP_002885762.1 competence type IV pilus minor pilin ComGF Machinery gene
  FOC73_RS04700 (FOC73_04700) comGE 990133..990363 (-) 231 WP_002885825.1 competence type IV pilus minor pilin ComGE Machinery gene
  FOC73_RS04705 (FOC73_04705) comGD 990395..990823 (-) 429 WP_014632541.1 competence type IV pilus minor pilin ComGD Machinery gene
  FOC73_RS04710 (FOC73_04710) comGC 990783..991097 (-) 315 WP_037611125.1 competence type IV pilus major pilin ComGC Machinery gene
  FOC73_RS04715 (FOC73_04715) comGB 991106..992206 (-) 1101 WP_157747911.1 competence type IV pilus assembly protein ComGB Machinery gene
  FOC73_RS04720 (FOC73_04720) comGA 992088..993029 (-) 942 WP_002885658.1 competence type IV pilus ATPase ComGA Machinery gene
  FOC73_RS04725 (FOC73_04725) - 993109..993471 (-) 363 WP_002885749.1 DUF1033 family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8413.81 Da        Isoelectric Point: 10.0924

>NTDB_id=396902 FOC73_RS04700 WP_002885825.1 990133..990363(-) (comGE) [Streptococcus salivarius strain FDAARGOS_771]
MAVLVLVSGLILEQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSQQGIAVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=396902 FOC73_RS04700 WP_002885825.1 990133..990363(-) (comGE) [Streptococcus salivarius strain FDAARGOS_771]
ATGGCTGTTTTAGTACTTGTCAGTGGTCTTATTTTGGAACAAATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCAACTATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGCATCACAGTGA
CGGTAAAACGTAGCCAGCAAGGTATCGCGGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

39.189

97.368

0.382

  comGE Streptococcus mutans UA159

39.189

97.368

0.382