Detailed information    

insolico Bioinformatically predicted

Overview

Name   comEA   Type   Machinery gene
Locus tag   DAAJ005_RS07360 Genome accession   NZ_CP044990
Coordinates   1137754..1138146 (-) Length   130 a.a.
NCBI ID   WP_151846545.1    Uniprot ID   A0A5J6YVJ1
Organism   Deinococcus sp. AJ005     
Function   dsDNA binding (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 1109836..1136760 1137754..1138146 flank 994


Gene organization within MGE regions


Location: 1109836..1138146
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DAAJ005_RS07255 (DAAJ005_07255) - 1109863..1110780 (+) 918 WP_370519793.1 IS110 family transposase -
  DAAJ005_RS19130 - 1110914..1111293 (-) 380 Protein_1013 IS4 family transposase -
  DAAJ005_RS07260 (DAAJ005_07260) - 1111368..1115042 (+) 3675 WP_192930895.1 type ISP restriction/modification enzyme -
  DAAJ005_RS07265 (DAAJ005_07265) - 1115158..1115607 (+) 450 WP_192930896.1 RES family NAD+ phosphorylase -
  DAAJ005_RS19135 - 1115709..1116260 (-) 552 Protein_1016 transposase -
  DAAJ005_RS19140 - 1116256..1116560 (-) 305 Protein_1017 IS982 family transposase -
  DAAJ005_RS07275 (DAAJ005_07275) - 1116844..1118790 (-) 1947 WP_151846531.1 TnsD family Tn7-like transposition protein -
  DAAJ005_RS07280 (DAAJ005_07280) - 1118794..1120455 (-) 1662 WP_151846532.1 ATP-binding protein -
  DAAJ005_RS07285 (DAAJ005_07285) - 1120452..1122692 (-) 2241 WP_151846533.1 Mu transposase C-terminal domain-containing protein -
  DAAJ005_RS07290 (DAAJ005_07290) - 1122689..1123537 (-) 849 WP_192930897.1 TnsA endonuclease N-terminal domain-containing protein -
  DAAJ005_RS07295 (DAAJ005_07295) - 1124038..1125099 (-) 1062 Protein_1022 IS4 family transposase -
  DAAJ005_RS07300 (DAAJ005_07300) - 1125244..1126833 (-) 1590 WP_151846535.1 hypothetical protein -
  DAAJ005_RS07305 (DAAJ005_07305) - 1126862..1127884 (-) 1023 WP_151846536.1 hypothetical protein -
  DAAJ005_RS07310 (DAAJ005_07310) - 1128593..1129558 (+) 966 Protein_1025 IS630 family transposase -
  DAAJ005_RS07315 (DAAJ005_07315) - 1129654..1130712 (-) 1059 WP_151846537.1 IS4 family transposase -
  DAAJ005_RS07320 (DAAJ005_07320) - 1130753..1132546 (-) 1794 WP_151846538.1 DUF4209 domain-containing protein -
  DAAJ005_RS19145 - 1132574..1133026 (-) 453 WP_255448053.1 transposase family protein -
  DAAJ005_RS19150 - 1132992..1133411 (-) 420 WP_226342624.1 transposase family protein -
  DAAJ005_RS07330 (DAAJ005_07330) - 1133575..1133829 (-) 255 WP_151846539.1 helix-turn-helix domain-containing protein -
  DAAJ005_RS07335 (DAAJ005_07335) - 1133959..1134315 (+) 357 WP_151846540.1 hypothetical protein -
  DAAJ005_RS07340 (DAAJ005_07340) - 1134315..1134974 (+) 660 WP_151846541.1 hypothetical protein -
  DAAJ005_RS07345 (DAAJ005_07345) - 1135088..1135435 (+) 348 WP_151846542.1 hypothetical protein -
  DAAJ005_RS07355 (DAAJ005_07355) comEC 1137042..1137731 (-) 690 WP_151846544.1 hypothetical protein Machinery gene
  DAAJ005_RS07360 (DAAJ005_07360) comEA 1137754..1138146 (-) 393 WP_151846545.1 helix-hairpin-helix domain-containing protein Machinery gene

Sequence

Protein


Download         Length: 130 a.a.        Molecular weight: 13480.97 Da        Isoelectric Point: 10.9513

>NTDB_id=391142 DAAJ005_RS07360 WP_151846545.1 1137754..1138146(-) (comEA) [Deinococcus sp. AJ005]
MINNERGWTLGLGAGVLLVGALALGPVLLPRPQVPTVTRVALPPPSAPAVPTARTEPPTFPTTASIKPLISGRVNLNTAS
QEQLEALPKVGPSMALKIIAARPIRSQADLDAIKGVGEATLKLLLPLVSY

Nucleotide


Download         Length: 393 bp        

>NTDB_id=391142 DAAJ005_RS07360 WP_151846545.1 1137754..1138146(-) (comEA) [Deinococcus sp. AJ005]
GTGATCAACAACGAACGCGGCTGGACCCTGGGCCTGGGCGCTGGCGTGCTGCTGGTGGGCGCGCTGGCGCTGGGTCCGGT
GCTGCTGCCTCGCCCGCAAGTGCCAACAGTGACGCGCGTGGCTTTGCCGCCTCCGAGCGCTCCTGCTGTGCCGACAGCCA
GAACCGAACCGCCCACCTTTCCCACCACTGCCAGCATCAAACCGCTGATCTCGGGCCGGGTCAATCTGAATACGGCATCT
CAGGAGCAGCTTGAGGCCCTGCCCAAAGTCGGCCCGTCGATGGCCCTCAAGATCATCGCCGCGCGGCCCATTCGCTCACA
GGCCGATCTGGACGCCATCAAGGGCGTGGGCGAGGCGACGCTGAAGCTGCTCTTGCCCCTGGTCAGCTACTAG

Domains

Predicted by InterproScan.

Helix-hairpin-helix motif (HHH_3)

(73-126)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5J6YVJ1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comEA Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539

69.231

100

0.692

Multiple sequence alignment