Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   F0M21_RS11825 Genome accession   NZ_CP043546
Coordinates   2427956..2428222 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain SYP-B637     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2422956..2433222
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F0M21_RS11775 (F0M21_11775) sinR 2423120..2423455 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  F0M21_RS11780 (F0M21_11780) tasA 2423503..2424288 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  F0M21_RS11785 (F0M21_11785) sipW 2424353..2424937 (-) 585 WP_012117977.1 signal peptidase I SipW -
  F0M21_RS11790 (F0M21_11790) tapA 2424909..2425580 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  F0M21_RS11795 (F0M21_11795) - 2425839..2426168 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  F0M21_RS11800 (F0M21_11800) - 2426208..2426387 (-) 180 WP_003153093.1 YqzE family protein -
  F0M21_RS11805 (F0M21_11805) comGG 2426444..2426821 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  F0M21_RS11810 (F0M21_11810) comGF 2426822..2427322 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  F0M21_RS11815 (F0M21_11815) comGE 2427231..2427545 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  F0M21_RS11820 (F0M21_11820) comGD 2427529..2427966 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  F0M21_RS11825 (F0M21_11825) comGC 2427956..2428222 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  F0M21_RS11830 (F0M21_11830) comGB 2428269..2429306 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  F0M21_RS11835 (F0M21_11835) comGA 2429293..2430363 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  F0M21_RS11840 (F0M21_11840) - 2430560..2431510 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  F0M21_RS11845 (F0M21_11845) - 2431656..2432957 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=384981 F0M21_RS11825 WP_042635730.1 2427956..2428222(-) (comGC) [Bacillus velezensis strain SYP-B637]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=384981 F0M21_RS11825 WP_042635730.1 2427956..2428222(-) (comGC) [Bacillus velezensis strain SYP-B637]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGATCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment