Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   FHP15_RS20185 Genome accession   NZ_CP040880
Coordinates   3643677..3644456 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus paranthracis strain F3351/87     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3617056..3663091 3643677..3644456 within 0


Gene organization within MGE regions


Location: 3617056..3663091
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FHP15_RS20065 (FHP15_20040) - 3617250..3617501 (-) 252 WP_001239754.1 YlmC/YmxH family sporulation protein -
  FHP15_RS20070 (FHP15_20045) - 3617628..3618869 (-) 1242 WP_000592994.1 pitrilysin family protein -
  FHP15_RS20075 (FHP15_20050) - 3618956..3619855 (-) 900 WP_000647527.1 polysaccharide deacetylase family protein -
  FHP15_RS20080 (FHP15_20055) pnp 3620007..3622145 (-) 2139 WP_000076746.1 polyribonucleotide nucleotidyltransferase -
  FHP15_RS20085 (FHP15_20060) rpsO 3622306..3622575 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  FHP15_RS20090 (FHP15_20065) ribF 3622676..3623647 (-) 972 WP_000766710.1 bifunctional riboflavin kinase/FAD synthetase -
  FHP15_RS20095 (FHP15_20070) truB 3623691..3624614 (-) 924 WP_000399344.1 tRNA pseudouridine(55) synthase TruB -
  FHP15_RS20100 (FHP15_20075) rbfA 3624701..3625057 (-) 357 WP_000776440.1 30S ribosome-binding factor RbfA -
  FHP15_RS20105 (FHP15_20080) - 3625073..3625354 (-) 282 WP_000582364.1 DUF503 family protein -
  FHP15_RS20110 (FHP15_20085) infB 3625351..3627411 (-) 2061 WP_000036342.1 translation initiation factor IF-2 -
  FHP15_RS20115 (FHP15_20090) - 3627416..3627727 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  FHP15_RS20120 (FHP15_20095) - 3627728..3628000 (-) 273 WP_000071128.1 YlxR family protein -
  FHP15_RS20125 (FHP15_20100) nusA 3628012..3629118 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  FHP15_RS20130 (FHP15_20105) rimP 3629136..3629606 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  FHP15_RS20135 (FHP15_20110) - 3629939..3634240 (-) 4302 WP_000059980.1 PolC-type DNA polymerase III -
  FHP15_RS20140 (FHP15_20115) - 3634365..3636065 (-) 1701 WP_000814305.1 proline--tRNA ligase -
  FHP15_RS20145 (FHP15_20120) rseP 3636175..3637431 (-) 1257 WP_001090248.1 RIP metalloprotease RseP -
  FHP15_RS20150 (FHP15_20125) dxr 3637448..3638590 (-) 1143 WP_000790362.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  FHP15_RS20155 (FHP15_20130) cdsA 3638614..3639405 (-) 792 WP_000813584.1 phosphatidate cytidylyltransferase -
  FHP15_RS20160 (FHP15_20135) uppS 3639423..3640199 (-) 777 WP_000971301.1 isoprenyl transferase -
  FHP15_RS20165 (FHP15_20140) frr 3640285..3640842 (-) 558 WP_000531500.1 ribosome recycling factor -
  FHP15_RS20170 (FHP15_20145) pyrH 3640845..3641567 (-) 723 WP_000042663.1 UMP kinase -
  FHP15_RS20175 (FHP15_20150) tsf 3641634..3642521 (-) 888 WP_001018580.1 translation elongation factor Ts -
  FHP15_RS20180 (FHP15_20155) rpsB 3642625..3643326 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  FHP15_RS20185 (FHP15_20160) codY 3643677..3644456 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  FHP15_RS20190 (FHP15_20165) hslU 3644534..3645925 (-) 1392 WP_000550081.1 ATP-dependent protease ATPase subunit HslU -
  FHP15_RS20195 (FHP15_20170) hslV 3645948..3646490 (-) 543 WP_000526271.1 ATP-dependent protease proteolytic subunit HslV -
  FHP15_RS20200 (FHP15_20175) xerC 3646533..3647432 (-) 900 WP_001101229.1 tyrosine recombinase XerC -
  FHP15_RS20205 (FHP15_20180) trmFO 3647498..3648802 (-) 1305 WP_002028254.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  FHP15_RS20210 (FHP15_20185) topA 3648853..3650931 (-) 2079 WP_001286973.1 type I DNA topoisomerase -
  FHP15_RS20215 (FHP15_20190) dprA 3651076..3651945 (-) 870 WP_000818031.1 DNA-processing protein DprA -
  FHP15_RS20220 (FHP15_20195) sucD 3652033..3652935 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  FHP15_RS20225 (FHP15_20200) sucC 3652955..3654115 (-) 1161 WP_001020785.1 ADP-forming succinate--CoA ligase subunit beta -
  FHP15_RS20230 (FHP15_20205) rnhB 3654309..3655082 (-) 774 WP_001174725.1 ribonuclease HII -
  FHP15_RS20235 (FHP15_20210) ylqF 3655134..3656024 (-) 891 WP_000236700.1 ribosome biogenesis GTPase YlqF -
  FHP15_RS20240 (FHP15_20215) lepB 3656045..3656596 (-) 552 WP_000711857.1 signal peptidase I -
  FHP15_RS20245 (FHP15_20220) rplS 3656698..3657042 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  FHP15_RS20250 (FHP15_20225) trmD 3657189..3657923 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  FHP15_RS20255 (FHP15_20230) rimM 3657923..3658438 (-) 516 WP_000170268.1 ribosome maturation factor RimM -
  FHP15_RS20260 (FHP15_20235) - 3658562..3658789 (-) 228 WP_000737403.1 KH domain-containing protein -
  FHP15_RS20265 (FHP15_20240) rpsP 3658804..3659076 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  FHP15_RS20270 (FHP15_20245) ffh 3659177..3660526 (-) 1350 WP_000863461.1 signal recognition particle protein -
  FHP15_RS20275 (FHP15_20250) - 3660539..3660871 (-) 333 WP_000891062.1 putative DNA-binding protein -
  FHP15_RS20280 (FHP15_20255) ftsY 3661005..3661994 (-) 990 WP_000007646.1 signal recognition particle-docking protein FtsY -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=367880 FHP15_RS20185 WP_000421288.1 3643677..3644456(-) (codY) [Bacillus paranthracis strain F3351/87]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=367880 FHP15_RS20185 WP_000421288.1 3643677..3644456(-) (codY) [Bacillus paranthracis strain F3351/87]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAGCGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGCTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATTGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTACTAAACGACAAATTCTTACATGAACTTGCTAAATTGAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459


Multiple sequence alignment