Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   FGE23_RS17010 Genome accession   NZ_CP040672
Coordinates   3456702..3457016 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain X030     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3451702..3462016
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FGE23_RS16965 sinI 3452385..3452558 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  FGE23_RS16970 sinR 3452592..3452927 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  FGE23_RS16975 tasA 3452975..3453760 (-) 786 WP_094247735.1 biofilm matrix protein TasA -
  FGE23_RS16980 sipW 3453824..3454408 (-) 585 WP_012117977.1 signal peptidase I SipW -
  FGE23_RS16985 tapA 3454380..3455051 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  FGE23_RS16990 - 3455310..3455639 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  FGE23_RS16995 - 3455679..3455858 (-) 180 WP_003153093.1 YqzE family protein -
  FGE23_RS17000 comGG 3455915..3456292 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  FGE23_RS17005 comGF 3456293..3456688 (-) 396 WP_094247733.1 competence type IV pilus minor pilin ComGF -
  FGE23_RS17010 comGE 3456702..3457016 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  FGE23_RS17015 comGD 3457000..3457437 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  FGE23_RS17020 comGC 3457427..3457735 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  FGE23_RS17025 comGB 3457740..3458777 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  FGE23_RS17030 comGA 3458764..3459834 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  FGE23_RS17035 - 3460026..3460976 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=366386 FGE23_RS17010 WP_015388003.1 3456702..3457016(-) (comGE) [Bacillus amyloliquefaciens strain X030]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=366386 FGE23_RS17010 WP_015388003.1 3456702..3457016(-) (comGE) [Bacillus amyloliquefaciens strain X030]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment