Detailed information    

insolico Bioinformatically predicted

Overview


Name   xcpW   Type   Machinery gene
Locus tag   FE003_RS10695 Genome accession   NZ_CP040425
Coordinates   2203102..2203803 (-) Length   233 a.a.
NCBI ID   WP_000594589.1    Uniprot ID   A0A9P3CZ31
Organism   Acinetobacter baumannii strain PB364     
Function   pseudopilus assembly (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2154325..2213822 2203102..2203803 within 0


Gene organization within MGE regions


Location: 2154325..2213822
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FE003_RS10375 (FE003_10375) - 2154325..2154834 (-) 510 WP_000095892.1 lysozyme -
  FE003_RS10380 (FE003_10380) - 2154818..2155084 (-) 267 WP_000774828.1 holin -
  FE003_RS10385 (FE003_10385) - 2155159..2155383 (-) 225 WP_001104854.1 hypothetical protein -
  FE003_RS10390 (FE003_10390) - 2155385..2157421 (-) 2037 WP_002018761.1 hypothetical protein -
  FE003_RS10395 (FE003_10395) - 2157475..2160309 (-) 2835 WP_000078482.1 host specificity factor TipJ family phage tail protein -
  FE003_RS10400 (FE003_10400) - 2160260..2160655 (-) 396 WP_001026372.1 hypothetical protein -
  FE003_RS10405 (FE003_10405) - 2160652..2161161 (-) 510 WP_000587324.1 DUF1833 family protein -
  FE003_RS10410 (FE003_10410) - 2161164..2161625 (-) 462 WP_000882463.1 hypothetical protein -
  FE003_RS10415 (FE003_10415) - 2161641..2165234 (-) 3594 WP_000246490.1 transglycosylase SLT domain-containing protein -
  FE003_RS10420 (FE003_10420) - 2165297..2165629 (-) 333 WP_001031955.1 hypothetical protein -
  FE003_RS10425 (FE003_10425) - 2165706..2165921 (-) 216 WP_000498808.1 hypothetical protein -
  FE003_RS10430 (FE003_10430) - 2165957..2166472 (-) 516 WP_001074127.1 phage tail assembly chaperone family protein, TAC -
  FE003_RS10435 (FE003_10435) - 2166474..2166950 (-) 477 WP_001062223.1 phage tail tube protein -
  FE003_RS10440 (FE003_10440) - 2167022..2167396 (-) 375 WP_000598741.1 DUF3168 domain-containing protein -
  FE003_RS10445 (FE003_10445) - 2167396..2167881 (-) 486 WP_000235306.1 HK97-gp10 family putative phage morphogenesis protein -
  FE003_RS10450 (FE003_10450) - 2167885..2168241 (-) 357 WP_001139340.1 phage head closure protein -
  FE003_RS10455 (FE003_10455) - 2168243..2168530 (-) 288 WP_000631202.1 head-tail connector protein -
  FE003_RS20335 - 2168527..2168703 (-) 177 WP_000666092.1 hypothetical protein -
  FE003_RS10460 (FE003_10460) - 2168751..2169923 (-) 1173 WP_000137059.1 phage major capsid protein -
  FE003_RS10465 (FE003_10465) - 2169916..2170578 (-) 663 WP_000375469.1 HK97 family phage prohead protease -
  FE003_RS10470 (FE003_10470) - 2170571..2171797 (-) 1227 WP_000108393.1 phage portal protein -
  FE003_RS10475 (FE003_10475) - 2171794..2173485 (-) 1692 WP_000097334.1 terminase large subunit -
  FE003_RS10480 (FE003_10480) - 2173489..2173971 (-) 483 WP_001219088.1 terminase small subunit -
  FE003_RS20675 - 2173993..2174118 (-) 126 WP_000983284.1 hypothetical protein -
  FE003_RS10485 (FE003_10485) - 2174118..2174342 (-) 225 WP_000202128.1 hypothetical protein -
  FE003_RS10490 (FE003_10490) - 2174387..2174686 (-) 300 WP_000776297.1 HNH endonuclease -
  FE003_RS10495 (FE003_10495) - 2174616..2174909 (-) 294 WP_001079329.1 hypothetical protein -
  FE003_RS10500 (FE003_10500) - 2174915..2175097 (-) 183 WP_000063945.1 hypothetical protein -
  FE003_RS10505 (FE003_10505) - 2175087..2175617 (-) 531 WP_000433065.1 hypothetical protein -
  FE003_RS10510 (FE003_10510) - 2175655..2176041 (-) 387 WP_000693736.1 hypothetical protein -
  FE003_RS20340 - 2176144..2176419 (-) 276 WP_002019135.1 hypothetical protein -
  FE003_RS20345 - 2176412..2176585 (-) 174 WP_000774599.1 hypothetical protein -
  FE003_RS10515 (FE003_10515) - 2176876..2177772 (-) 897 WP_000572117.1 hypothetical protein -
  FE003_RS10520 (FE003_10520) - 2177838..2178332 (-) 495 WP_001086184.1 hypothetical protein -
  FE003_RS10525 (FE003_10525) - 2178329..2178610 (-) 282 WP_000064051.1 hypothetical protein -
  FE003_RS10530 (FE003_10530) - 2178603..2179208 (-) 606 WP_000801886.1 hypothetical protein -
  FE003_RS10535 (FE003_10535) - 2179205..2179483 (-) 279 WP_000846972.1 hypothetical protein -
  FE003_RS10540 (FE003_10540) - 2179480..2180811 (-) 1332 WP_000507046.1 replicative DNA helicase -
  FE003_RS10545 (FE003_10545) - 2180811..2181695 (-) 885 WP_002006015.1 YdaU family protein -
  FE003_RS10550 (FE003_10550) - 2181695..2181991 (-) 297 WP_001005281.1 hypothetical protein -
  FE003_RS10555 (FE003_10555) - 2182050..2182235 (-) 186 WP_002028116.1 hypothetical protein -
  FE003_RS10560 (FE003_10560) - 2182364..2183056 (+) 693 WP_002028118.1 S24 family peptidase -
  FE003_RS10565 (FE003_10565) - 2183306..2184037 (+) 732 WP_138067724.1 hypothetical protein -
  FE003_RS10570 (FE003_10570) - 2184040..2184456 (+) 417 WP_001260746.1 hypothetical protein -
  FE003_RS10580 (FE003_10580) - 2184679..2185095 (+) 417 WP_000073111.1 hypothetical protein -
  FE003_RS10585 (FE003_10585) - 2185105..2185665 (+) 561 WP_000739593.1 hypothetical protein -
  FE003_RS10590 (FE003_10590) - 2185674..2186042 (+) 369 WP_000160441.1 hypothetical protein -
  FE003_RS10595 (FE003_10595) - 2186042..2186812 (+) 771 WP_001067109.1 phage repressor protein/antirepressor Ant -
  FE003_RS10600 (FE003_10600) - 2186809..2187060 (+) 252 WP_000141159.1 hypothetical protein -
  FE003_RS10605 (FE003_10605) - 2187026..2187985 (-) 960 WP_000190203.1 tyrosine-type recombinase/integrase -
  FE003_RS10610 (FE003_10610) zapE 2188162..2189304 (-) 1143 WP_000933387.1 cell division protein ZapE -
  FE003_RS10615 (FE003_10615) - 2189388..2190407 (-) 1020 WP_000830356.1 helix-turn-helix domain-containing protein -
  FE003_RS10620 (FE003_10620) - 2190529..2192076 (+) 1548 WP_014538345.1 flavin-containing monooxygenase -
  FE003_RS10625 (FE003_10625) - 2192126..2192557 (+) 432 Protein_2058 hypothetical protein -
  FE003_RS10630 (FE003_10630) - 2192626..2193716 (+) 1091 WP_085940413.1 IS4-like element ISAba1 family transposase -
  FE003_RS10635 (FE003_10635) - 2193735..2194226 (+) 492 Protein_2060 lysine exporter LysO family protein -
  FE003_RS10640 (FE003_10640) pyrF 2194223..2194921 (-) 699 WP_000392928.1 orotidine-5'-phosphate decarboxylase -
  FE003_RS10645 (FE003_10645) - 2195087..2195452 (-) 366 WP_001269278.1 lipopolysaccharide assembly protein LapA domain-containing protein -
  FE003_RS10650 (FE003_10650) - 2195477..2195779 (-) 303 WP_000205997.1 integration host factor subunit beta -
  FE003_RS10655 (FE003_10655) rpsA 2195936..2197609 (-) 1674 WP_000140309.1 30S ribosomal protein S1 -
  FE003_RS10660 (FE003_10660) cmk 2197714..2198400 (-) 687 WP_000218018.1 (d)CMP kinase -
  FE003_RS10665 (FE003_10665) - 2198408..2198851 (-) 444 WP_001246675.1 SRPBCC family protein -
  FE003_RS10670 (FE003_10670) tadA 2198921..2199424 (-) 504 WP_000033178.1 tRNA adenosine(34) deaminase TadA -
  FE003_RS10675 (FE003_10675) - 2199431..2200555 (-) 1125 WP_001983908.1 enoyl-CoA hydratase/isomerase family protein -
  FE003_RS10680 (FE003_10680) ung 2200552..2201265 (-) 714 WP_001177528.1 uracil-DNA glycosylase -
  FE003_RS10685 (FE003_10685) - 2201316..2201912 (-) 597 WP_000908452.1 6-pyruvoyl trahydropterin synthase family protein -
  FE003_RS10690 (FE003_10690) gspK 2202143..2203102 (-) 960 WP_000301476.1 type II secretion system minor pseudopilin GspK -
  FE003_RS10695 (FE003_10695) xcpW 2203102..2203803 (-) 702 WP_000594589.1 type II secretion system minor pseudopilin GspJ Machinery gene
  FE003_RS10700 (FE003_10700) xcpV 2203803..2204183 (-) 381 WP_000836911.1 type II secretion system minor pseudopilin GspI Machinery gene
  FE003_RS10705 (FE003_10705) - 2204173..2204727 (-) 555 WP_000841373.1 type II secretion system protein -
  FE003_RS10710 (FE003_10710) - 2204737..2205345 (-) 609 WP_000375838.1 TetR/AcrR family transcriptional regulator -
  FE003_RS10715 (FE003_10715) - 2205383..2206156 (-) 774 WP_000497298.1 TatD family hydrolase -
  FE003_RS10720 (FE003_10720) - 2206174..2206515 (-) 342 WP_001183024.1 PilZ domain-containing protein -
  FE003_RS10725 (FE003_10725) - 2206527..2207507 (-) 981 WP_001075411.1 DNA polymerase III subunit delta' -
  FE003_RS10730 (FE003_10730) kdsB 2207519..2208280 (-) 762 WP_000680697.1 3-deoxy-manno-octulosonate cytidylyltransferase -
  FE003_RS10735 (FE003_10735) lpxK 2208290..2209300 (-) 1011 WP_000050464.1 tetraacyldisaccharide 4'-kinase -
  FE003_RS10740 (FE003_10740) msbA 2209303..2211030 (-) 1728 WP_001070734.1 lipid A export permease/ATP-binding protein MsbA -
  FE003_RS10745 (FE003_10745) - 2211027..2211455 (-) 429 WP_000669684.1 ExbD/TolR family protein -
  FE003_RS10750 (FE003_10750) - 2211471..2212106 (-) 636 WP_000264037.1 MotA/TolQ/ExbB proton channel family protein -
  FE003_RS10755 (FE003_10755) - 2212156..2213043 (-) 888 WP_000023433.1 ParB/RepB/Spo0J family partition protein -
  FE003_RS10760 (FE003_10760) - 2213040..2213822 (-) 783 WP_000057212.1 ParA family protein -

Sequence


Protein


Download         Length: 233 a.a.        Molecular weight: 26639.58 Da        Isoelectric Point: 9.3468

>NTDB_id=364288 FE003_RS10695 WP_000594589.1 2203102..2203803(-) (xcpW) [Acinetobacter baumannii strain PB364]
MIKNKYIHIRSIDSRLAARSSSARLTRASGFTLVELLVAIAIFAVLSLLGWKIFDYLLKVRDRNAEHEVHLFELQDAYQQ
ILRDTLQIIPLSANQGGQLHPALEIDNQILRFSKAGVTDPLKQGLSPFERIEYRYDADQKKLYRLKYTNLNTSNREQPLS
STLLSQVDQYQIMVLTPQEVTKWPEVNIDPTKPNELKKLPKGIKIQLTVAGVNYEWIYSLNQGDLSLSQEGNS

Nucleotide


Download         Length: 702 bp        

>NTDB_id=364288 FE003_RS10695 WP_000594589.1 2203102..2203803(-) (xcpW) [Acinetobacter baumannii strain PB364]
ATGATAAAAAATAAATATATTCACATCCGAAGCATTGATTCTCGCCTTGCAGCACGATCGAGCAGTGCTCGATTAACTCG
CGCCTCAGGATTTACTTTGGTTGAATTGTTAGTCGCGATCGCTATCTTTGCGGTTTTATCTTTATTGGGGTGGAAAATTT
TCGATTACTTGCTCAAAGTTCGTGATCGTAATGCCGAACATGAAGTGCATTTATTTGAATTACAAGATGCTTATCAACAA
ATTCTTCGTGATACTTTGCAGATTATCCCTTTATCCGCAAACCAAGGTGGTCAACTTCATCCAGCTTTAGAAATCGATAA
TCAAATTTTACGTTTTAGCAAAGCAGGCGTAACGGATCCTTTAAAACAAGGCTTATCACCATTTGAACGAATTGAATATC
GTTATGATGCAGACCAAAAAAAATTATATCGTCTTAAATATACAAATTTGAATACTTCGAACAGAGAGCAACCTTTATCG
AGTACTTTGTTAAGTCAAGTCGACCAATATCAGATTATGGTTTTGACTCCGCAAGAAGTCACAAAATGGCCCGAGGTTAA
TATTGATCCAACGAAACCTAATGAGTTAAAAAAATTACCGAAAGGGATAAAAATCCAACTTACAGTCGCTGGTGTAAATT
ATGAGTGGATTTATAGCTTAAATCAGGGTGACTTATCGCTTTCGCAGGAAGGTAATTCATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  xcpW Acinetobacter baumannii D1279779

99.571

100

0.996


Multiple sequence alignment