Detailed information NTG0035701

Bioinformatically predicted

Overview

• Name: comGF
• Type: Machinery gene
• Locus tag: LL3_RS12690
• Genome accession: NC_017190
• Coordinates: 2508907..2509407 (-)
• Length: 166 a.a.
• NCBI ID: WP_013352868.1
• Uniprot ID: A0A9P1JIL5
• Organism: Bacillus amyloliquefaciens LL3
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2503907..2514407

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LL3_RS12645 (LL3_02655)	-	2504026..2504820 (+)	795	WP_014472099.1	YqhG family protein	-
LL3_RS12650 (LL3_02657)	sinI	2505000..2505173 (+)	174	WP_013352860.1	anti-repressor SinI	Regulator
LL3_RS12655 (LL3_02658)	sinR	2505207..2505542 (+)	336	WP_014470659.1	transcriptional regulator SinR	Regulator
LL3_RS12660 (LL3_02659)	tasA	2505590..2506375 (-)	786	WP_013352862.1	biofilm matrix protein TasA	-
LL3_RS12665 (LL3_02660)	sipW	2506440..2507024 (-)	585	WP_013352863.1	signal peptidase I SipW	-
LL3_RS12670 (LL3_02661)	tapA	2506996..2507667 (-)	672	WP_013352864.1	amyloid fiber anchoring/assembly protein TapA	-
LL3_RS12675 (LL3_02662)	-	2507925..2508254 (+)	330	WP_013352865.1	DUF3889 domain-containing protein	-
LL3_RS12680 (LL3_02663)	-	2508295..2508474 (-)	180	WP_013352866.1	YqzE family protein	-
LL3_RS12685 (LL3_02664)	comGG	2508528..2508905 (-)	378	WP_013352867.1	competence type IV pilus minor pilin ComGG	Machinery gene
LL3_RS12690 (LL3_02665)	comGF	2508907..2509407 (-)	501	WP_013352868.1	competence type IV pilus minor pilin ComGF	Machinery gene
LL3_RS12695 (LL3_02666)	comGE	2509316..2509630 (-)	315	WP_014470662.1	competence type IV pilus minor pilin ComGE	Machinery gene
LL3_RS12700 (LL3_02667)	comGD	2509614..2510051 (-)	438	WP_013352869.1	competence type IV pilus minor pilin ComGD	Machinery gene
LL3_RS12705 (LL3_02668)	comGC	2510041..2510307 (-)	267	WP_044051905.1	competence type IV pilus major pilin ComGC	Machinery gene
LL3_RS12710 (LL3_02669)	comGB	2510354..2511391 (-)	1038	WP_013352871.1	competence type IV pilus assembly protein ComGB	Machinery gene
LL3_RS12715 (LL3_02670)	comGA	2511378..2512448 (-)	1071	WP_013352872.1	competence type IV pilus ATPase ComGA	Machinery gene
LL3_RS12720 (LL3_02672)	-	2512642..2513592 (-)	951	WP_013352873.1	magnesium transporter CorA family protein	-

Sequence

Protein

• Length: 166 a.a.
• Molecular weight: 17813.77 Da
• Isoelectric Point: 10.2182

>NTDB_id=35701 LL3_RS12690 WP_013352868.1 2508907..2509407(-) (comGF) [Bacillus amyloliquefaciens LL3]
MVIITKSVQLSAAKKKCASAFSKQTGFTLLNVLVSLAVCLFLSGTLSPILHLFLSGRTDNGGIDSREHHIAVQQIMNECK
QAETVEPADGGRALTCRKTGGEEVRFEIYHTMIRKRVNGKGHVPILHNAASLTADVKNGLILVGITSVTGKKKQTAIPVY
SSLKGD

Nucleotide

• Length: 501 bp

>NTDB_id=35701 LL3_RS12690 WP_013352868.1 2508907..2509407(-) (comGF) [Bacillus amyloliquefaciens LL3]
ATGGTGATTATTACAAAGTCTGTGCAGCTGTCCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTT
TACGCTTCTTAATGTTTTGGTCTCCTTGGCCGTCTGTCTCTTCTTATCAGGCACTCTGAGCCCGATTTTACATTTGTTTT
TATCAGGCCGGACCGATAACGGAGGAATAGACAGCCGGGAGCATCATATTGCCGTTCAGCAGATCATGAATGAATGTAAA
CAGGCTGAGACTGTGGAGCCTGCAGATGGCGGACGGGCGTTAACCTGCAGGAAAACAGGAGGCGAAGAAGTGCGTTTTGA
AATCTATCACACGATGATAAGGAAAAGAGTGAACGGAAAAGGCCATGTGCCGATCCTGCATAACGCTGCTTCATTAACGG
CTGATGTGAAAAACGGCCTGATTTTAGTGGGAATCACAAGCGTTACAGGTAAAAAGAAGCAGACGGCCATTCCGGTTTAC
AGCTCTTTAAAAGGTGATTAA

Domains

Predicted by InterProScan.

• Putative Competence protein ComGF (ComGF) (65-152)

3D structure

• AlphaFold DB: A0A9P1JIL5

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF	Bacillus subtilis subsp. subtilis str. 168	47.619	75.904	0.361