Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   FPL20_RS12130 Genome accession   NZ_CP045478
Coordinates   2297846..2298229 (+) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   P25958
Organism   Bacillus subtilis strain JD-014     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2292846..2303229
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FPL20_RS12100 (FPL20_GE02276) corA 2293299..2294252 (+) 954 WP_004399136.1 magnesium transporter CorA -
  FPL20_RS12105 (FPL20_GE02278) comGA 2294664..2295734 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  FPL20_RS12110 (FPL20_GE02279) comGB 2295721..2296758 (+) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  FPL20_RS12115 (FPL20_GE02280) comGC 2296772..2297068 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  FPL20_RS12120 (FPL20_GE02281) comGD 2297058..2297489 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  FPL20_RS12125 (FPL20_GE02282) comGE 2297473..2297820 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  FPL20_RS12130 (FPL20_GE02283) comGF 2297846..2298229 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  FPL20_RS12135 (FPL20_GE02284) comGG 2298230..2298604 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  FPL20_RS12140 (FPL20_GE02285) spoIITA 2298675..2298854 (+) 180 WP_003230176.1 YqzE family protein -
  FPL20_RS12145 (FPL20_GE02286) yqzG 2298896..2299222 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  FPL20_RS12150 (FPL20_GE02287) tapA 2299494..2300255 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  FPL20_RS12155 (FPL20_GE02288) sipW 2300239..2300811 (+) 573 WP_003246088.1 signal peptidase I SipW -
  FPL20_RS12160 (FPL20_GE02289) tasA 2300875..2301660 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  FPL20_RS12165 (FPL20_GE02290) sinR 2301753..2302088 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  FPL20_RS12170 (FPL20_GE02291) sinI 2302122..2302295 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=344717 FPL20_RS12130 WP_003230168.1 2297846..2298229(+) (comGF) [Bacillus subtilis strain JD-014]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=344717 FPL20_RS12130 WP_003230168.1 2297846..2298229(+) (comGF) [Bacillus subtilis strain JD-014]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25958

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment