Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   EQH95_RS13290 Genome accession   NZ_CP035162
Coordinates   2473191..2473574 (-) Length   127 a.a.
NCBI ID   WP_029317913.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103886     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2468191..2478574
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH95_RS13250 (EQH95_13250) sinI 2469125..2469298 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  EQH95_RS13255 (EQH95_13255) sinR 2469332..2469667 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQH95_RS13260 (EQH95_13260) tasA 2469760..2470545 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  EQH95_RS13265 (EQH95_13265) sipW 2470609..2471181 (-) 573 WP_003230181.1 signal peptidase I SipW -
  EQH95_RS13270 (EQH95_13270) tapA 2471165..2471926 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  EQH95_RS13275 (EQH95_13275) yqzG 2472198..2472524 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EQH95_RS13280 (EQH95_13280) spoIITA 2472566..2472745 (-) 180 WP_014480252.1 YqzE family protein -
  EQH95_RS13285 (EQH95_13285) comGG 2472816..2473190 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  EQH95_RS13290 (EQH95_13290) comGF 2473191..2473574 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  EQH95_RS13295 (EQH95_13295) comGE 2473600..2473947 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  EQH95_RS13300 (EQH95_13300) comGD 2473931..2474362 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  EQH95_RS13305 (EQH95_13305) comGC 2474352..2474648 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  EQH95_RS13310 (EQH95_13310) comGB 2474662..2475699 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  EQH95_RS13315 (EQH95_13315) comGA 2475686..2476756 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  EQH95_RS13320 (EQH95_13320) - 2476968..2477165 (-) 198 WP_014480259.1 CBS domain-containing protein -
  EQH95_RS13325 (EQH95_13325) corA 2477167..2478120 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14363.43 Da        Isoelectric Point: 5.8949

>NTDB_id=335041 EQH95_RS13290 WP_029317913.1 2473191..2473574(-) (comGF) [Bacillus subtilis strain SRCM103886]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=335041 EQH95_RS13290 WP_029317913.1 2473191..2473574(-) (comGF) [Bacillus subtilis strain SRCM103886]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976


Multiple sequence alignment