Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   EKQ63_RS20385 Genome accession   NZ_CP034686
Coordinates   3538055..3538834 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus sp. BD59S     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3511431..3557468 3538055..3538834 within 0


Gene organization within MGE regions


Location: 3511431..3557468
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EKQ63_RS20265 (EKQ63_20245) - 3511626..3511877 (-) 252 WP_001239749.1 YlmC/YmxH family sporulation protein -
  EKQ63_RS20270 (EKQ63_20250) - 3512008..3513249 (-) 1242 WP_000592994.1 M16 family metallopeptidase -
  EKQ63_RS20275 (EKQ63_20255) - 3513336..3514235 (-) 900 WP_087954503.1 polysaccharide deacetylase family protein -
  EKQ63_RS20280 (EKQ63_20260) pnp 3514387..3516525 (-) 2139 WP_086421443.1 polyribonucleotide nucleotidyltransferase -
  EKQ63_RS20285 (EKQ63_20265) rpsO 3516686..3516955 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  EKQ63_RS20290 (EKQ63_20270) ribF 3517056..3518027 (-) 972 WP_000766719.1 bifunctional riboflavin kinase/FAD synthetase -
  EKQ63_RS20295 (EKQ63_20275) truB 3518071..3518994 (-) 924 WP_061131602.1 tRNA pseudouridine(55) synthase TruB -
  EKQ63_RS20300 (EKQ63_20280) rbfA 3519081..3519437 (-) 357 WP_000776443.1 30S ribosome-binding factor RbfA -
  EKQ63_RS20305 (EKQ63_20285) - 3519453..3519734 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  EKQ63_RS20310 (EKQ63_20290) infB 3519731..3521791 (-) 2061 WP_000036341.1 translation initiation factor IF-2 -
  EKQ63_RS20315 (EKQ63_20295) - 3521796..3522107 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  EKQ63_RS20320 (EKQ63_20300) rnpM 3522108..3522380 (-) 273 WP_000071128.1 RNase P modulator RnpM -
  EKQ63_RS20325 (EKQ63_20305) nusA 3522392..3523498 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  EKQ63_RS20330 (EKQ63_20310) rimP 3523516..3523986 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  EKQ63_RS20335 (EKQ63_20315) - 3524319..3528620 (-) 4302 WP_087954502.1 PolC-type DNA polymerase III -
  EKQ63_RS20340 (EKQ63_20320) - 3528745..3530445 (-) 1701 WP_087954501.1 proline--tRNA ligase -
  EKQ63_RS20345 (EKQ63_20325) rseP 3530555..3531811 (-) 1257 WP_139866977.1 RIP metalloprotease RseP -
  EKQ63_RS20350 (EKQ63_20330) dxr 3531828..3532970 (-) 1143 WP_087954499.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  EKQ63_RS20355 (EKQ63_20335) cdsA 3532994..3533785 (-) 792 WP_000813584.1 phosphatidate cytidylyltransferase -
  EKQ63_RS20360 (EKQ63_20340) uppS 3533803..3534579 (-) 777 WP_046198502.1 isoprenyl transferase -
  EKQ63_RS20365 (EKQ63_20345) frr 3534665..3535222 (-) 558 WP_000531503.1 ribosome recycling factor -
  EKQ63_RS20370 (EKQ63_20350) pyrH 3535225..3535947 (-) 723 WP_000042663.1 UMP kinase -
  EKQ63_RS20375 (EKQ63_20355) tsf 3536014..3536901 (-) 888 WP_001018581.1 translation elongation factor Ts -
  EKQ63_RS20380 (EKQ63_20360) rpsB 3537005..3537706 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  EKQ63_RS20385 (EKQ63_20365) codY 3538055..3538834 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  EKQ63_RS20390 (EKQ63_20370) hslU 3538912..3540303 (-) 1392 WP_000550082.1 ATP-dependent protease ATPase subunit HslU -
  EKQ63_RS20395 (EKQ63_20375) hslV 3540326..3540868 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  EKQ63_RS20400 (EKQ63_20380) xerC 3540911..3541810 (-) 900 WP_087954498.1 tyrosine recombinase XerC -
  EKQ63_RS20405 (EKQ63_20385) trmFO 3541876..3543180 (-) 1305 WP_002028254.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  EKQ63_RS20410 (EKQ63_20390) topA 3543231..3545309 (-) 2079 WP_046198501.1 type I DNA topoisomerase -
  EKQ63_RS20415 (EKQ63_20395) dprA 3545454..3546323 (-) 870 WP_087954497.1 DNA-processing protein DprA -
  EKQ63_RS20420 (EKQ63_20400) sucD 3546411..3547313 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  EKQ63_RS20425 (EKQ63_20405) sucC 3547333..3548493 (-) 1161 WP_001020785.1 ADP-forming succinate--CoA ligase subunit beta -
  EKQ63_RS20430 (EKQ63_20410) rnhB 3548687..3549460 (-) 774 WP_087954496.1 ribonuclease HII -
  EKQ63_RS20435 (EKQ63_20415) ylqF 3549513..3550403 (-) 891 WP_000236700.1 ribosome biogenesis GTPase YlqF -
  EKQ63_RS20440 (EKQ63_20420) lepB 3550424..3550975 (-) 552 WP_000711857.1 signal peptidase I -
  EKQ63_RS20445 (EKQ63_20425) rplS 3551077..3551421 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  EKQ63_RS20450 (EKQ63_20430) trmD 3551568..3552302 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  EKQ63_RS20455 (EKQ63_20435) rimM 3552302..3552817 (-) 516 WP_000170268.1 ribosome maturation factor RimM -
  EKQ63_RS20460 (EKQ63_20440) - 3552939..3553166 (-) 228 WP_000737398.1 KH domain-containing protein -
  EKQ63_RS20465 (EKQ63_20445) rpsP 3553181..3553453 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  EKQ63_RS20470 (EKQ63_20450) ffh 3553554..3554903 (-) 1350 WP_087954495.1 signal recognition particle protein -
  EKQ63_RS20475 (EKQ63_20455) - 3554916..3555248 (-) 333 WP_000891062.1 putative DNA-binding protein -
  EKQ63_RS20480 (EKQ63_20460) ftsY 3555382..3556371 (-) 990 WP_087954494.1 signal recognition particle-docking protein FtsY -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=332494 EKQ63_RS20385 WP_000421288.1 3538055..3538834(-) (codY) [Bacillus sp. BD59S]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=332494 EKQ63_RS20385 WP_000421288.1 3538055..3538834(-) (codY) [Bacillus sp. BD59S]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAATGTATTCGTAGTAAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAGCGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATTGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCAGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459


Multiple sequence alignment