Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   EJ379_RS19560 Genome accession   NZ_CP034551
Coordinates   3805431..3806210 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus cereus ATCC 14579     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3780138..3841896 3805431..3806210 within 0


Gene organization within MGE regions


Location: 3780138..3841896
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EJ379_RS19450 (EJ379_19445) - 3780708..3781607 (-) 900 WP_000868217.1 polysaccharide deacetylase family protein -
  EJ379_RS19455 (EJ379_19450) pnp 3781759..3783897 (-) 2139 WP_000076737.1 polyribonucleotide nucleotidyltransferase -
  EJ379_RS19460 (EJ379_19455) rpsO 3784058..3784327 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  EJ379_RS19465 (EJ379_19460) ribF 3784428..3785399 (-) 972 WP_000766706.1 bifunctional riboflavin kinase/FAD synthetase -
  EJ379_RS19470 (EJ379_19465) truB 3785443..3786366 (-) 924 WP_000399352.1 tRNA pseudouridine(55) synthase TruB -
  EJ379_RS19475 (EJ379_19470) rbfA 3786453..3786809 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  EJ379_RS19480 (EJ379_19475) - 3786825..3787106 (-) 282 WP_000582363.1 DUF503 family protein -
  EJ379_RS19485 (EJ379_19480) infB 3787103..3789163 (-) 2061 WP_000036343.1 translation initiation factor IF-2 -
  EJ379_RS19490 (EJ379_19485) - 3789168..3789479 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  EJ379_RS19495 (EJ379_19490) - 3789480..3789752 (-) 273 WP_000071127.1 YlxR family protein -
  EJ379_RS19500 (EJ379_19495) nusA 3789764..3790870 (-) 1107 WP_000102602.1 transcription termination factor NusA -
  EJ379_RS19505 (EJ379_19500) rimP 3790888..3791358 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  EJ379_RS19510 (EJ379_19505) - 3791695..3795996 (-) 4302 WP_000060005.1 PolC-type DNA polymerase III -
  EJ379_RS19515 (EJ379_19510) - 3796121..3797821 (-) 1701 WP_000814302.1 proline--tRNA ligase -
  EJ379_RS19520 (EJ379_19515) rseP 3797931..3799187 (-) 1257 WP_001090244.1 RIP metalloprotease RseP -
  EJ379_RS19525 (EJ379_19520) dxr 3799205..3800347 (-) 1143 WP_000790373.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  EJ379_RS19530 (EJ379_19525) cdsA 3800371..3801162 (-) 792 WP_000813592.1 phosphatidate cytidylyltransferase -
  EJ379_RS19535 (EJ379_19530) uppS 3801180..3801956 (-) 777 WP_000971296.1 isoprenyl transferase -
  EJ379_RS19540 (EJ379_19535) frr 3802042..3802599 (-) 558 WP_000531501.1 ribosome recycling factor -
  EJ379_RS19545 (EJ379_19540) pyrH 3802602..3803324 (-) 723 WP_000042668.1 UMP kinase -
  EJ379_RS19550 (EJ379_19545) tsf 3803391..3804278 (-) 888 WP_001018578.1 translation elongation factor Ts -
  EJ379_RS19555 (EJ379_19550) rpsB 3804382..3805083 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  EJ379_RS19560 (EJ379_19555) codY 3805431..3806210 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  EJ379_RS19565 (EJ379_19560) hslU 3806288..3807679 (-) 1392 WP_000550078.1 ATP-dependent protease ATPase subunit HslU -
  EJ379_RS19570 (EJ379_19565) hslV 3807702..3808244 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  EJ379_RS19575 (EJ379_19570) xerC 3808287..3809186 (-) 900 WP_001101243.1 tyrosine recombinase XerC -
  EJ379_RS19580 (EJ379_19575) trmFO 3809252..3810556 (-) 1305 WP_000213003.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  EJ379_RS19585 (EJ379_19580) topA 3810605..3812683 (-) 2079 WP_001286963.1 type I DNA topoisomerase -
  EJ379_RS19590 (EJ379_19585) dprA 3812828..3813697 (-) 870 WP_000818060.1 DNA-processing protein DprA -
  EJ379_RS19595 (EJ379_19590) sucD 3813786..3814688 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  EJ379_RS19600 (EJ379_19595) sucC 3814708..3815868 (-) 1161 WP_001020791.1 ADP-forming succinate--CoA ligase subunit beta -
  EJ379_RS19605 (EJ379_19600) - 3816063..3816836 (-) 774 WP_001194268.1 ribonuclease HII -
  EJ379_RS19610 (EJ379_19605) ylqF 3816893..3817783 (-) 891 WP_000236704.1 ribosome biogenesis GTPase YlqF -
  EJ379_RS19615 (EJ379_19610) lepB 3817804..3818355 (-) 552 WP_000711853.1 signal peptidase I -
  EJ379_RS19620 (EJ379_19615) rplS 3818457..3818801 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  EJ379_RS19625 (EJ379_19620) trmD 3818948..3819682 (-) 735 WP_000686903.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  EJ379_RS19630 (EJ379_19625) rimM 3819682..3820197 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  EJ379_RS19635 (EJ379_19630) - 3820319..3820546 (-) 228 WP_000737401.1 KH domain-containing protein -
  EJ379_RS19640 (EJ379_19635) rpsP 3820561..3820833 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  EJ379_RS19645 (EJ379_19640) ffh 3820935..3822284 (-) 1350 WP_000863460.1 signal recognition particle protein -
  EJ379_RS19650 (EJ379_19645) - 3822297..3822629 (-) 333 WP_000891062.1 putative DNA-binding protein -
  EJ379_RS19655 (EJ379_19650) ftsY 3822763..3823752 (-) 990 WP_000007656.1 signal recognition particle-docking protein FtsY -
  EJ379_RS19660 (EJ379_19655) smc 3823768..3827337 (-) 3570 WP_000478972.1 chromosome segregation protein SMC -
  EJ379_RS19665 (EJ379_19660) rncS 3827484..3828221 (-) 738 WP_001146875.1 ribonuclease III -
  EJ379_RS19670 (EJ379_19665) acpP 3828280..3828513 (-) 234 WP_000786062.1 acyl carrier protein -
  EJ379_RS19675 (EJ379_19670) fabG 3828583..3829323 (-) 741 WP_000911773.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  EJ379_RS19680 (EJ379_19675) fabD 3829323..3830267 (-) 945 WP_000515899.1 ACP S-malonyltransferase -
  EJ379_RS19685 (EJ379_19680) plsX 3830282..3831274 (-) 993 WP_000684092.1 phosphate acyltransferase PlsX -
  EJ379_RS19690 (EJ379_19685) fapR 3831271..3831864 (-) 594 WP_000747348.1 transcription factor FapR -
  EJ379_RS19695 (EJ379_19690) recG 3831953..3834001 (-) 2049 WP_001000816.1 ATP-dependent DNA helicase RecG -
  EJ379_RS19700 (EJ379_19695) - 3834292..3835968 (-) 1677 WP_000027130.1 DAK2 domain-containing protein -
  EJ379_RS19705 (EJ379_19700) - 3835991..3836353 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  EJ379_RS19710 (EJ379_19705) rpmB 3836730..3836918 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  EJ379_RS19715 (EJ379_19710) spoVM 3836992..3837072 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  EJ379_RS19720 (EJ379_19715) - 3837139..3837819 (-) 681 WP_002026234.1 thiamine diphosphokinase -
  EJ379_RS19725 (EJ379_19720) rpe 3837888..3838532 (-) 645 WP_000589959.1 ribulose-phosphate 3-epimerase -
  EJ379_RS19730 (EJ379_19725) rsgA 3838535..3839416 (-) 882 WP_001113932.1 ribosome small subunit-dependent GTPase A -
  EJ379_RS19735 (EJ379_19730) pknB 3839663..3841636 (-) 1974 WP_000904747.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=331867 EJ379_RS19560 WP_000421290.1 3805431..3806210(-) (codY) [Bacillus cereus ATCC 14579]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=331867 EJ379_RS19560 WP_000421290.1 3805431..3806210(-) (codY) [Bacillus cereus ATCC 14579]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCGCGTAGTAAAGCTGTTGTTCAAATGGCAATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GCTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAAGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459


Multiple sequence alignment