Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilH   Type   Machinery gene
Locus tag   EGH12_RS07735 Genome accession   NZ_CP034020
Coordinates   1319527..1320189 (-) Length   220 a.a.
NCBI ID   WP_047916986.1    Uniprot ID   A0AA44U7R7
Organism   Neisseria gonorrhoeae strain FQ48     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1265363..1330139 1319527..1320189 within 0


Gene organization within MGE regions


Location: 1265363..1330139
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EGH12_RS07345 (EGH12_07345) - 1265363..1266016 (-) 654 WP_050157023.1 IS1595 family transposase -
  EGH12_RS07355 (EGH12_07355) purM 1267013..1268047 (-) 1035 WP_003691398.1 phosphoribosylformylglycinamidine cyclo-ligase -
  EGH12_RS07365 (EGH12_07365) - 1268736..1269725 (+) 990 WP_003689040.1 site-specific integrase -
  EGH12_RS07375 (EGH12_07375) - 1270067..1270546 (+) 480 WP_002241413.1 DUF4760 domain-containing protein -
  EGH12_RS07380 (EGH12_07380) - 1270606..1273653 (-) 3048 WP_047953556.1 tape measure protein -
  EGH12_RS07385 (EGH12_07385) - 1273683..1273832 (-) 150 WP_003691402.1 hypothetical protein -
  EGH12_RS07390 (EGH12_07390) - 1274144..1274317 (-) 174 WP_003705498.1 hypothetical protein -
  EGH12_RS07395 (EGH12_07395) - 1274301..1274642 (-) 342 WP_003700102.1 hypothetical protein -
  EGH12_RS13485 - 1274626..1274784 (-) 159 WP_003691816.1 hypothetical protein -
  EGH12_RS07400 (EGH12_07400) - 1274784..1275323 (-) 540 WP_050153719.1 TIGR02594 family protein -
  EGH12_RS07410 (EGH12_07410) - 1275530..1275766 (+) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  EGH12_RS07415 (EGH12_07415) - 1275766..1276113 (+) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  EGH12_RS07420 (EGH12_07420) - 1276469..1276801 (-) 333 WP_003691408.1 hypothetical protein -
  EGH12_RS07425 (EGH12_07425) - 1276802..1277272 (-) 471 WP_003691410.1 hypothetical protein -
  EGH12_RS07430 (EGH12_07430) - 1277343..1277648 (-) 306 WP_003689058.1 hypothetical protein -
  EGH12_RS07435 (EGH12_07435) - 1277760..1281905 (-) 4146 WP_047921483.1 phage tail protein -
  EGH12_RS07440 (EGH12_07440) - 1282145..1282423 (+) 279 WP_003689062.1 XRE family transcriptional regulator -
  EGH12_RS07445 (EGH12_07445) - 1282451..1282882 (-) 432 WP_003689064.1 NlpC/P60 family protein -
  EGH12_RS07450 (EGH12_07450) - 1282884..1283738 (-) 855 WP_003698614.1 DUF2163 domain-containing protein -
  EGH12_RS07455 (EGH12_07455) - 1283735..1284334 (-) 600 WP_003691415.1 DUF2460 domain-containing protein -
  EGH12_RS07460 (EGH12_07460) - 1284334..1284600 (-) 267 WP_003689070.1 hypothetical protein -
  EGH12_RS07465 (EGH12_07465) - 1284612..1284941 (-) 330 WP_003692871.1 hypothetical protein -
  EGH12_RS07470 (EGH12_07470) - 1285002..1285775 (-) 774 WP_003691416.1 hypothetical protein -
  EGH12_RS07475 (EGH12_07475) - 1285801..1286229 (-) 429 WP_003689076.1 hypothetical protein -
  EGH12_RS07480 (EGH12_07480) - 1286226..1286708 (-) 483 WP_044271038.1 HK97 gp10 family phage protein -
  EGH12_RS07485 (EGH12_07485) - 1286708..1287238 (-) 531 WP_003689080.1 head-tail connector protein -
  EGH12_RS13830 (EGH12_07490) - 1287241..1287603 (-) 363 WP_003689082.1 hypothetical protein -
  EGH12_RS07495 (EGH12_07495) - 1287610..1289109 (-) 1500 WP_003691419.1 hypothetical protein -
  EGH12_RS07500 (EGH12_07500) - 1289150..1290307 (-) 1158 WP_003691421.1 HK97 family phage prohead protease -
  EGH12_RS07505 (EGH12_07505) - 1290375..1292522 (-) 2148 WP_003691423.1 phage portal protein -
  EGH12_RS07510 (EGH12_07510) terL 1292519..1293940 (-) 1422 WP_003689090.1 phage terminase large subunit -
  EGH12_RS07515 (EGH12_07515) - 1294002..1294451 (-) 450 WP_003689093.1 hypothetical protein -
  EGH12_RS07520 (EGH12_07520) - 1294744..1295613 (-) 870 WP_050153721.1 Bro-N domain-containing protein -
  EGH12_RS07525 (EGH12_07525) - 1295894..1297054 (-) 1161 WP_047921542.1 type I restriction endonuclease -
  EGH12_RS07530 (EGH12_07530) - 1297145..1297552 (-) 408 WP_003691430.1 hypothetical protein -
  EGH12_RS14555 - 1297674..1297802 (+) 129 WP_012503747.1 hypothetical protein -
  EGH12_RS07540 (EGH12_07540) - 1297819..1298199 (-) 381 WP_033910829.1 RusA family crossover junction endodeoxyribonuclease -
  EGH12_RS14400 - 1298190..1298471 (-) 282 WP_003689109.1 hypothetical protein -
  EGH12_RS07545 (EGH12_07545) - 1298500..1298649 (-) 150 WP_003689110.1 hypothetical protein -
  EGH12_RS07550 (EGH12_07550) - 1298826..1299320 (-) 495 WP_041421248.1 DUF3310 domain-containing protein -
  EGH12_RS07555 (EGH12_07555) - 1299359..1299622 (-) 264 WP_154235845.1 hypothetical protein -
  EGH12_RS07560 (EGH12_07560) - 1299659..1300903 (-) 1245 WP_124935097.1 DnaB-like helicase C-terminal domain-containing protein -
  EGH12_RS07565 (EGH12_07565) - 1300900..1301964 (-) 1065 WP_050154181.1 hypothetical protein -
  EGH12_RS07570 (EGH12_07570) - 1302082..1302309 (-) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  EGH12_RS07580 (EGH12_07580) - 1302690..1303406 (+) 717 WP_003695999.1 helix-turn-helix transcriptional regulator -
  EGH12_RS07585 (EGH12_07585) - 1303566..1304105 (+) 540 WP_003695998.1 type II toxin-antitoxin system antitoxin SocA domain-containing protein -
  EGH12_RS07590 (EGH12_07590) - 1304106..1304465 (+) 360 WP_003691733.1 hypothetical protein -
  EGH12_RS07595 (EGH12_07595) - 1304482..1304700 (-) 219 WP_003691731.1 hypothetical protein -
  EGH12_RS07600 (EGH12_07600) - 1305184..1305384 (+) 201 WP_047920246.1 hypothetical protein -
  EGH12_RS07605 (EGH12_07605) - 1305417..1305893 (+) 477 WP_002255718.1 hypothetical protein -
  EGH12_RS07610 (EGH12_07610) - 1305890..1306177 (+) 288 WP_041421246.1 hypothetical protein -
  EGH12_RS07615 (EGH12_07615) - 1306318..1306650 (+) 333 WP_003705604.1 hypothetical protein -
  EGH12_RS07620 (EGH12_07620) - 1306803..1307081 (+) 279 WP_003691529.1 hypothetical protein -
  EGH12_RS07625 (EGH12_07625) - 1307078..1307239 (+) 162 WP_003693867.1 hypothetical protein -
  EGH12_RS07630 (EGH12_07630) - 1307308..1307994 (+) 687 WP_042758540.1 hypothetical protein -
  EGH12_RS07635 (EGH12_07635) - 1308134..1308316 (+) 183 WP_003691535.1 hypothetical protein -
  EGH12_RS07640 (EGH12_07640) - 1308313..1308804 (+) 492 WP_047916888.1 siphovirus Gp157 family protein -
  EGH12_RS07645 (EGH12_07645) - 1308856..1309071 (+) 216 WP_003691538.1 hypothetical protein -
  EGH12_RS14715 - 1309182..1309415 (+) 234 Protein_1322 hypothetical protein -
  EGH12_RS07655 (EGH12_07655) - 1309729..1310412 (+) 684 WP_003687929.1 DUF2786 domain-containing protein -
  EGH12_RS07660 (EGH12_07660) - 1310607..1310876 (+) 270 WP_003687928.1 hypothetical protein -
  EGH12_RS07675 (EGH12_07675) - 1311232..1312432 (-) 1201 Protein_1325 integrase arm-type DNA-binding domain-containing protein -
  EGH12_RS07690 (EGH12_07690) yaaA 1312962..1313741 (-) 780 WP_003687925.1 peroxide stress protein YaaA -
  EGH12_RS07695 (EGH12_07695) dapC 1313897..1315084 (-) 1188 WP_003701073.1 succinyldiaminopimelate transaminase -
  EGH12_RS07700 (EGH12_07700) dut 1315156..1315608 (-) 453 WP_003701071.1 dUTP diphosphatase -
  EGH12_RS07705 (EGH12_07705) - 1315774..1316485 (+) 712 Protein_1329 AzlC family ABC transporter permease -
  EGH12_RS07710 (EGH12_07710) - 1316482..1316790 (+) 309 WP_003706588.1 AzlD family protein -
  EGH12_RS07715 (EGH12_07715) pilL 1316860..1317333 (-) 474 WP_012503482.1 PilX family type IV pilin Machinery gene
  EGH12_RS07720 (EGH12_07720) pilK 1317335..1317943 (-) 609 WP_047921847.1 pilus assembly protein Machinery gene
  EGH12_RS07725 (EGH12_07725) pilJ 1317922..1318884 (-) 963 WP_047921846.1 PilW family protein Machinery gene
  EGH12_RS07730 (EGH12_07730) pilI 1318881..1319495 (-) 615 WP_012503479.1 type IV pilus modification protein PilV Machinery gene
  EGH12_RS07735 (EGH12_07735) pilH 1319527..1320189 (-) 663 WP_047916986.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  EGH12_RS07740 (EGH12_07740) dnaB 1320446..1321849 (-) 1404 WP_012503477.1 replicative DNA helicase -
  EGH12_RS07750 (EGH12_07750) - 1322013..1322594 (+) 582 WP_003690895.1 superoxide dismutase -
  EGH12_RS07760 (EGH12_07760) - 1322826..1323335 (-) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  EGH12_RS07765 (EGH12_07765) - 1323665..1323997 (-) 333 WP_003687908.1 hypothetical protein -
  EGH12_RS07770 (EGH12_07770) cysT 1324183..1325012 (+) 830 Protein_1340 sulfate ABC transporter permease subunit CysT -
  EGH12_RS07775 (EGH12_07775) cysW 1325201..1326022 (+) 822 WP_012503473.1 sulfate ABC transporter permease subunit CysW -
  EGH12_RS13835 - 1326018..1326125 (+) 108 Protein_1342 IS5/IS1182 family transposase -
  EGH12_RS07780 (EGH12_07780) - 1326163..1327239 (+) 1077 WP_003687905.1 sulfate/molybdate ABC transporter ATP-binding protein -
  EGH12_RS07785 (EGH12_07785) ilvA 1327295..1328821 (-) 1527 WP_003690890.1 threonine ammonia-lyase, biosynthetic -
  EGH12_RS07790 (EGH12_07790) - 1328970..1330139 (+) 1170 WP_003690889.1 D-alanyl-D-alanine carboxypeptidase family protein -

Sequence


Protein


Download         Length: 220 a.a.        Molecular weight: 24557.00 Da        Isoelectric Point: 9.6166

>NTDB_id=328147 EGH12_RS07735 WP_047916986.1 1319527..1320189(-) (pilH) [Neisseria gonorrhoeae strain FQ48]
MCTRKQQGFTLTELLIVMAIAAIMATIALPNMSGWIASRRIASHAEQVANLLRFSRGEAVRLNLPVYICPVQVKKDGASN
NRCDFSKKGWGMLAFGDKNDNKAYDGDATDVFLRSVVLNDTDDSRINYTFNHIAFGSSQPKADRVVWTFNQNGTFGYLPD
QNLKNNFKFVYSDGYIQIVLTDARAVSDADKKFRSAVVLINSSGRVEVCRKNDTRAVCKH

Nucleotide


Download         Length: 663 bp        

>NTDB_id=328147 EGH12_RS07735 WP_047916986.1 1319527..1320189(-) (pilH) [Neisseria gonorrhoeae strain FQ48]
ATGTGTACACGAAAACAACAAGGTTTCACGCTAACAGAGCTGCTCATCGTGATGGCCATCGCAGCCATTATGGCGACGAT
AGCCCTCCCCAATATGAGTGGGTGGATTGCATCACGCCGCATTGCCAGTCACGCGGAGCAGGTTGCCAACCTTTTGCGTT
TCTCCAGGGGCGAAGCCGTCCGGCTCAATCTCCCTGTCTATATCTGTCCTGTTCAAGTTAAAAAAGACGGTGCGTCCAAC
AATAGATGTGACTTCAGCAAGAAGGGGTGGGGAATGTTGGCTTTCGGCGACAAAAACGACAATAAGGCATATGACGGCGA
TGCGACGGATGTTTTCCTCCGCAGCGTGGTGTTGAATGATACCGACGACAGCCGGATTAATTACACCTTCAATCATATCG
CTTTCGGTTCGTCTCAGCCGAAAGCCGACCGTGTAGTTTGGACTTTCAACCAAAACGGGACATTCGGCTATTTGCCCGAT
CAGAATCTCAAGAATAATTTCAAATTTGTTTATTCTGACGGTTATATCCAAATCGTGCTGACAGATGCGAGAGCAGTTTC
AGATGCCGATAAGAAATTCCGTTCGGCGGTGGTTTTGATTAACAGCAGCGGCAGGGTCGAAGTTTGTCGTAAAAACGATA
CGCGCGCCGTATGCAAACATTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilH Neisseria gonorrhoeae MS11

95.455

100

0.955


Multiple sequence alignment