Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   BCAH820_RS19120 Genome accession   NC_011773
Coordinates   3678014..3678793 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus cereus AH820     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3643729..3717618 3678014..3678793 within 0


Gene organization within MGE regions


Location: 3643729..3717618
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BCAH820_RS18965 (BCAH820_3809) - 3644072..3645742 (-) 1671 WP_000823085.1 ribonuclease J -
  BCAH820_RS18975 (BCAH820_3810) dapA 3646508..3647386 (-) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  BCAH820_RS18980 (BCAH820_3811) dapG 3647398..3648630 (-) 1233 WP_000692470.1 aspartate kinase -
  BCAH820_RS18985 (BCAH820_3812) asd 3648654..3649700 (-) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  BCAH820_RS18990 (BCAH820_3813) dpaB 3649851..3650450 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  BCAH820_RS18995 (BCAH820_3814) dpaA 3650447..3651349 (-) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  BCAH820_RS19000 (BCAH820_3815) - 3651585..3651836 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  BCAH820_RS19005 (BCAH820_3816) - 3651963..3653204 (-) 1242 WP_000592993.1 M16 family metallopeptidase -
  BCAH820_RS19010 (BCAH820_3817) - 3653291..3654190 (-) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  BCAH820_RS19015 (BCAH820_3818) pnp 3654342..3656480 (-) 2139 WP_000076749.1 polyribonucleotide nucleotidyltransferase -
  BCAH820_RS19020 (BCAH820_3819) rpsO 3656641..3656910 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  BCAH820_RS19025 (BCAH820_3820) ribF 3657011..3657982 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  BCAH820_RS19030 (BCAH820_3821) truB 3658026..3658949 (-) 924 WP_000399337.1 tRNA pseudouridine(55) synthase TruB -
  BCAH820_RS19035 (BCAH820_3822) rbfA 3659036..3659392 (-) 357 WP_000776441.1 30S ribosome-binding factor RbfA -
  BCAH820_RS19040 (BCAH820_3823) - 3659408..3659689 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  BCAH820_RS19045 infB 3659686..3661748 (-) 2063 Protein_3705 translation initiation factor IF-2 -
  BCAH820_RS19050 (BCAH820_3826) - 3661753..3662064 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  BCAH820_RS19055 (BCAH820_3827) rnpM 3662065..3662337 (-) 273 WP_000071128.1 RNase P modulator RnpM -
  BCAH820_RS19060 (BCAH820_3828) nusA 3662349..3663455 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  BCAH820_RS19065 (BCAH820_3829) rimP 3663473..3663943 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  BCAH820_RS19070 (BCAH820_3830) - 3664276..3668577 (-) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  BCAH820_RS19075 (BCAH820_3831) - 3668702..3670402 (-) 1701 WP_000814312.1 proline--tRNA ligase -
  BCAH820_RS19080 (BCAH820_3832) rseP 3670512..3671768 (-) 1257 WP_001090229.1 RIP metalloprotease RseP -
  BCAH820_RS19085 (BCAH820_3833) dxr 3671785..3672927 (-) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  BCAH820_RS19090 (BCAH820_3834) cdsA 3672951..3673742 (-) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  BCAH820_RS19095 (BCAH820_3835) uppS 3673760..3674536 (-) 777 WP_000971301.1 isoprenyl transferase -
  BCAH820_RS19100 (BCAH820_3836) frr 3674622..3675179 (-) 558 WP_000531503.1 ribosome recycling factor -
  BCAH820_RS19105 (BCAH820_3837) pyrH 3675182..3675904 (-) 723 WP_000042663.1 UMP kinase -
  BCAH820_RS19110 (BCAH820_3838) tsf 3675971..3676858 (-) 888 WP_001018581.1 translation elongation factor Ts -
  BCAH820_RS19115 (BCAH820_3839) rpsB 3676962..3677663 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  BCAH820_RS19120 (BCAH820_3840) codY 3678014..3678793 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  BCAH820_RS19125 (BCAH820_3841) hslU 3678871..3680262 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  BCAH820_RS19130 (BCAH820_3842) hslV 3680285..3680827 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  BCAH820_RS19135 (BCAH820_3843) xerC 3680870..3681769 (-) 900 WP_001101227.1 tyrosine recombinase XerC -
  BCAH820_RS19140 (BCAH820_3844) trmFO 3681835..3683139 (-) 1305 WP_001991958.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  BCAH820_RS19145 (BCAH820_3845) topA 3683190..3685268 (-) 2079 WP_001286969.1 type I DNA topoisomerase -
  BCAH820_RS19150 (BCAH820_3846) dprA 3685413..3686282 (-) 870 WP_000818037.1 DNA-processing protein DprA -
  BCAH820_RS19155 (BCAH820_3847) sucD 3686370..3687272 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  BCAH820_RS19160 sucC 3687293..3688454 (-) 1162 Protein_3728 ADP-forming succinate--CoA ligase subunit beta -
  BCAH820_RS19165 (BCAH820_3850) rnhB 3688648..3689421 (-) 774 WP_001174715.1 ribonuclease HII -
  BCAH820_RS19170 (BCAH820_3851) ylqF 3689473..3690363 (-) 891 WP_000236696.1 ribosome biogenesis GTPase YlqF -
  BCAH820_RS19175 (BCAH820_3852) lepB 3690384..3690935 (-) 552 WP_000711856.1 signal peptidase I -
  BCAH820_RS19180 (BCAH820_3853) rplS 3691037..3691381 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  BCAH820_RS19185 (BCAH820_3854) trmD 3691528..3692262 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  BCAH820_RS19190 rimM 3692262..3692778 (-) 517 Protein_3734 ribosome maturation factor RimM -
  BCAH820_RS19195 (BCAH820_3857) - 3692899..3693126 (-) 228 WP_000737398.1 KH domain-containing protein -
  BCAH820_RS19200 (BCAH820_3858) rpsP 3693141..3693413 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  BCAH820_RS19205 (BCAH820_3859) ffh 3693514..3694863 (-) 1350 WP_000863461.1 signal recognition particle protein -
  BCAH820_RS19210 (BCAH820_3860) - 3694876..3695208 (-) 333 WP_000891062.1 putative DNA-binding protein -
  BCAH820_RS19215 (BCAH820_3861) ftsY 3695342..3696331 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  BCAH820_RS19220 (BCAH820_3862) smc 3696347..3699916 (-) 3570 WP_000478992.1 chromosome segregation protein SMC -
  BCAH820_RS19225 (BCAH820_3863) rncS 3700063..3700800 (-) 738 WP_001146873.1 ribonuclease III -
  BCAH820_RS19230 (BCAH820_3864) acpP 3700859..3701092 (-) 234 WP_000786062.1 acyl carrier protein -
  BCAH820_RS19235 (BCAH820_3865) fabG 3701162..3701902 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  BCAH820_RS19240 (BCAH820_3866) fabD 3701902..3702846 (-) 945 WP_000516946.1 ACP S-malonyltransferase -
  BCAH820_RS19245 (BCAH820_3867) plsX 3702861..3703853 (-) 993 WP_000684110.1 phosphate acyltransferase PlsX -
  BCAH820_RS19250 (BCAH820_3868) fapR 3703850..3704443 (-) 594 WP_000747352.1 transcription factor FapR -
  BCAH820_RS19255 (BCAH820_3869) recG 3704532..3706580 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  BCAH820_RS19260 (BCAH820_3870) - 3706870..3708546 (-) 1677 WP_000027138.1 DAK2 domain-containing protein -
  BCAH820_RS19265 (BCAH820_3871) - 3708569..3708931 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  BCAH820_RS19270 (BCAH820_3872) rpmB 3709310..3709498 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  BCAH820_RS19275 spoVM 3709572..3709652 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  BCAH820_RS19280 (BCAH820_3873) - 3709719..3710399 (-) 681 WP_025388434.1 thiamine diphosphokinase -
  BCAH820_RS19285 (BCAH820_3874) rpe 3710499..3711143 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  BCAH820_RS19290 (BCAH820_3875) rsgA 3711146..3712027 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  BCAH820_RS19295 (BCAH820_3876) prkC 3712294..3714267 (-) 1974 WP_000904757.1 serine/threonine protein kinase PrkC -
  BCAH820_RS19300 (BCAH820_3877) - 3714276..3715028 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  BCAH820_RS19305 (BCAH820_3878) rlmN 3715033..3716121 (-) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  BCAH820_RS19310 (BCAH820_3879) rsmB 3716126..3717460 (-) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=32460 BCAH820_RS19120 WP_000421288.1 3678014..3678793(-) (codY) [Bacillus cereus AH820]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=32460 BCAH820_RS19120 WP_000421288.1 3678014..3678793(-) (codY) [Bacillus cereus AH820]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459

Multiple sequence alignment