Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   EEB07_RS01825 Genome accession   NZ_CP033576
Coordinates   360762..361028 (-) Length   88 a.a.
NCBI ID   WP_050496152.1    Uniprot ID   -
Organism   Bacillus velezensis strain NY12-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 355762..366028
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EEB07_RS01775 (EEB07_01775) sinR 355925..356260 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  EEB07_RS01780 (EEB07_01780) - 356308..357093 (-) 786 WP_017418136.1 TasA family protein -
  EEB07_RS01785 (EEB07_01785) - 357158..357742 (-) 585 WP_012117977.1 signal peptidase I -
  EEB07_RS01790 (EEB07_01790) tapA 357714..358385 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  EEB07_RS01795 (EEB07_01795) - 358644..358973 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  EEB07_RS01800 (EEB07_01800) - 359014..359193 (-) 180 WP_003153093.1 YqzE family protein -
  EEB07_RS01805 (EEB07_01805) comGG 359250..359627 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  EEB07_RS01810 (EEB07_01810) comGF 359628..360023 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  EEB07_RS01815 (EEB07_01815) comGE 360037..360351 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  EEB07_RS01820 (EEB07_01820) comGD 360335..360772 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene
  EEB07_RS01825 (EEB07_01825) comGC 360762..361028 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  EEB07_RS01830 (EEB07_01830) comGB 361075..362112 (-) 1038 WP_123117329.1 competence type IV pilus assembly protein ComGB Machinery gene
  EEB07_RS01835 (EEB07_01835) comGA 362099..363169 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  EEB07_RS01840 (EEB07_01840) - 363362..364312 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  EEB07_RS01845 (EEB07_01845) - 364458..365759 (+) 1302 WP_017418142.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9740.36 Da        Isoelectric Point: 6.4456

>NTDB_id=324026 EEB07_RS01825 WP_050496152.1 360762..361028(-) (comGC) [Bacillus velezensis strain NY12-2]
MLIVLFIVSILLLITIPNVTKHNQSIQRKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=324026 EEB07_RS01825 WP_050496152.1 360762..361028(-) (comGC) [Bacillus velezensis strain NY12-2]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCGTAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

73.611

81.818

0.602


Multiple sequence alignment