Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   D9842_RS12490 Genome accession   NZ_CP033043
Coordinates   2503493..2503807 (-) Length   104 a.a.
NCBI ID   WP_121662824.1    Uniprot ID   -
Organism   Metabacillus litoralis strain Bac94     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2498493..2508807
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9842_RS12435 - 2499065..2499439 (+) 375 WP_121662813.1 XRE family transcriptional regulator -
  D9842_RS12440 - 2499440..2499580 (+) 141 WP_121662814.1 anti-repressor SinI family protein -
  D9842_RS12445 - 2499759..2500361 (-) 603 WP_121662815.1 hypothetical protein -
  D9842_RS12450 - 2500358..2500636 (-) 279 WP_121662816.1 hypothetical protein -
  D9842_RS12455 - 2500711..2501025 (+) 315 WP_121662817.1 DUF3889 domain-containing protein -
  D9842_RS12460 - 2501160..2501354 (-) 195 WP_121662818.1 YqzE family protein -
  D9842_RS12465 - 2501389..2501904 (-) 516 WP_121662819.1 shikimate kinase -
  D9842_RS12470 comGG 2501946..2502326 (-) 381 WP_121662820.1 competence type IV pilus minor pilin ComGG -
  D9842_RS12475 comGF 2502323..2502826 (-) 504 WP_257536038.1 competence type IV pilus minor pilin ComGF -
  D9842_RS12480 comGE 2502750..2503097 (-) 348 WP_121662822.1 competence type IV pilus minor pilin ComGE -
  D9842_RS12485 comGD 2503063..2503518 (-) 456 WP_162987416.1 competence type IV pilus minor pilin ComGD -
  D9842_RS12490 comGC 2503493..2503807 (-) 315 WP_121662824.1 competence type IV pilus major pilin ComGC Machinery gene
  D9842_RS12495 comGB 2503818..2504852 (-) 1035 WP_162987417.1 competence type IV pilus assembly protein ComGB -
  D9842_RS12500 comGA 2504842..2505909 (-) 1068 WP_121662826.1 competence type IV pilus ATPase ComGA Machinery gene
  D9842_RS12510 - 2506529..2506909 (-) 381 WP_121662827.1 Spx/MgsR family RNA polymerase-binding regulatory protein -
  D9842_RS12515 - 2507252..2507500 (+) 249 WP_098799530.1 DUF2626 domain-containing protein -
  D9842_RS12520 - 2507563..2508195 (-) 633 WP_121662828.1 MBL fold metallo-hydrolase -
  D9842_RS12525 - 2508449..2508622 (+) 174 WP_098799532.1 DUF2759 domain-containing protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11029.93 Da        Isoelectric Point: 7.1314

>NTDB_id=320606 D9842_RS12490 WP_121662824.1 2503493..2503807(-) (comGC) [Metabacillus litoralis strain Bac94]
MKKEKGFTLIEMLIVLLVITVLLLITIPNVTKHNSSIQEKGCDGLINMVQAQVTSYQIDHKKIPTVGELQTGGYLRSKPV
CPNGNTVAIAADGVVSDGGAPAVD

Nucleotide


Download         Length: 315 bp        

>NTDB_id=320606 D9842_RS12490 WP_121662824.1 2503493..2503807(-) (comGC) [Metabacillus litoralis strain Bac94]
ATGAAGAAAGAAAAAGGTTTTACGTTAATAGAAATGCTAATTGTATTACTGGTTATAACGGTATTACTGCTTATTACAAT
TCCAAATGTAACAAAGCATAATAGCAGTATTCAAGAAAAAGGCTGTGATGGGCTTATTAATATGGTACAGGCTCAAGTAA
CATCTTATCAAATTGATCATAAAAAAATTCCTACAGTAGGAGAACTACAAACCGGTGGCTATCTACGAAGTAAACCTGTA
TGTCCAAATGGTAATACGGTTGCAATTGCTGCAGATGGAGTTGTTTCTGATGGAGGAGCACCAGCAGTCGATTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

58.427

85.577

0.5


Multiple sequence alignment