Detailed information
Bioinformatically predicted
Overview
| Name | comB3 | Type | Machinery gene |
| Locus tag | D4H51_RS06630 | Genome accession | NZ_CP032480 |
| Coordinates | 1369751..1370014 (-) | Length | 87 a.a. |
| NCBI ID | WP_128036898.1 | Uniprot ID | A0AB37V0S2 |
| Organism | Helicobacter pylori strain 19-C-EK1 | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1292705..1372669 | 1369751..1370014 | within | 0 |
Gene organization within MGE regions
Location: 1292705..1372669
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D4H51_RS06330 | hopM | 1293509..1295590 (+) | 2082 | WP_275543481.1 | Hop family outer membrane protein HopM/HopN | - |
| D4H51_RS06335 | - | 1295803..1296636 (+) | 834 | WP_139544383.1 | sulfite exporter TauE/SafE family protein | - |
| D4H51_RS06340 | msrB | 1297012..1298091 (-) | 1080 | WP_139544384.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| D4H51_RS06345 | radA | 1298215..1299561 (-) | 1347 | WP_201737145.1 | DNA repair protein RadA | - |
| D4H51_RS06350 | - | 1299673..1299906 (-) | 234 | WP_000415833.1 | ribbon-helix-helix domain-containing protein | - |
| D4H51_RS06355 | - | 1300062..1301042 (-) | 981 | WP_139544386.1 | iron-sulfur cluster assembly scaffold protein | - |
| D4H51_RS06360 | - | 1301064..1302227 (-) | 1164 | WP_033744554.1 | NifS family cysteine desulfurase | - |
| D4H51_RS06365 | - | 1302398..1302859 (-) | 462 | WP_139544387.1 | helix-turn-helix domain-containing protein | - |
| D4H51_RS06370 | - | 1302925..1303556 (+) | 632 | Protein_1221 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| D4H51_RS06375 | dxr | 1303738..1304838 (-) | 1101 | WP_139544389.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
| D4H51_RS06380 | - | 1304839..1305639 (-) | 801 | WP_139544390.1 | phosphatidate cytidylyltransferase | - |
| D4H51_RS06385 | - | 1305652..1307310 (-) | 1659 | WP_139544391.1 | DASS family sodium-coupled anion symporter | - |
| D4H51_RS06390 | mnmG | 1307406..1309271 (+) | 1866 | WP_139544392.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG | - |
| D4H51_RS06395 | dapE | 1309282..1310433 (+) | 1152 | WP_139544393.1 | succinyl-diaminopimelate desuccinylase | - |
| D4H51_RS06400 | hcpA | 1310890..1311642 (+) | 753 | WP_139544394.1 | Sel1-like repeat protein HcpA | - |
| D4H51_RS06405 | htpG | 1311837..1313702 (-) | 1866 | WP_139544395.1 | molecular chaperone HtpG | - |
| D4H51_RS06410 | hofA | 1313806..1315158 (-) | 1353 | WP_139544654.1 | outer membrane beta-barrel protein HofA | - |
| D4H51_RS08600 | - | 1315321..1315474 (+) | 154 | Protein_1230 | glycosyltransferase family 8 protein | - |
| D4H51_RS06415 | - | 1315461..1316564 (+) | 1104 | WP_236633633.1 | glycosyltransferase | - |
| D4H51_RS06420 | - | 1316578..1317816 (-) | 1239 | WP_139544397.1 | Mrp/NBP35 family ATP-binding protein | - |
| D4H51_RS06425 | - | 1317781..1320627 (+) | 2847 | WP_139544398.1 | hypothetical protein | - |
| D4H51_RS06430 | - | 1321535..1323571 (+) | 2037 | WP_201737089.1 | relaxase/mobilization nuclease domain-containing protein | - |
| D4H51_RS06435 | - | 1324656..1325723 (+) | 1068 | WP_139544399.1 | tyrosine-type recombinase/integrase | - |
| D4H51_RS06440 | - | 1326036..1326833 (-) | 798 | WP_139544400.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| D4H51_RS06445 | - | 1326805..1327056 (-) | 252 | WP_120823133.1 | hypothetical protein | - |
| D4H51_RS08710 | - | 1327303..1327975 (-) | 673 | Protein_1238 | CAAX protease | - |
| D4H51_RS06465 | - | 1328155..1329169 (+) | 1015 | Protein_1239 | hypothetical protein | - |
| D4H51_RS06470 | - | 1329174..1330451 (-) | 1278 | WP_139544403.1 | hypothetical protein | - |
| D4H51_RS08605 | - | 1330448..1331708 (-) | 1261 | Protein_1241 | P-type conjugative transfer protein TrbL | - |
| D4H51_RS06485 | - | 1331705..1333138 (-) | 1434 | WP_139544404.1 | hypothetical protein | - |
| D4H51_RS06490 | - | 1333148..1335151 (-) | 2004 | WP_139544405.1 | hypothetical protein | - |
| D4H51_RS06495 | - | 1335151..1336203 (-) | 1053 | WP_139544406.1 | ArdC-like ssDNA-binding domain-containing protein | - |
| D4H51_RS08430 | - | 1336204..1336368 (-) | 165 | WP_000189763.1 | hypothetical protein | - |
| D4H51_RS06500 | - | 1337005..1337673 (+) | 669 | WP_139544407.1 | ParA family protein | - |
| D4H51_RS06505 | - | 1337720..1338097 (+) | 378 | WP_000365707.1 | hypothetical protein | - |
| D4H51_RS06510 | tnpA | 1338282..1338749 (+) | 468 | WP_000063685.1 | IS200/IS605 family transposase | - |
| D4H51_RS06515 | - | 1338718..1339866 (+) | 1149 | WP_139543879.1 | RNA-guided endonuclease TnpB family protein | - |
| D4H51_RS06520 | - | 1339953..1340579 (+) | 627 | WP_139544408.1 | hypothetical protein | - |
| D4H51_RS06525 | - | 1340653..1341456 (-) | 804 | WP_139544409.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| D4H51_RS06530 | - | 1341426..1341896 (-) | 471 | WP_000965788.1 | hypothetical protein | - |
| D4H51_RS06535 | - | 1341951..1344011 (-) | 2061 | WP_139544410.1 | type IA DNA topoisomerase | - |
| D4H51_RS06540 | - | 1344151..1344402 (-) | 252 | WP_108593827.1 | hypothetical protein | - |
| D4H51_RS08640 | - | 1344413..1344535 (-) | 123 | WP_258222686.1 | hypothetical protein | - |
| D4H51_RS06545 | - | 1344539..1344763 (-) | 225 | WP_139544411.1 | hypothetical protein | - |
| D4H51_RS06550 | - | 1344756..1344953 (-) | 198 | WP_108593828.1 | hypothetical protein | - |
| D4H51_RS06555 | - | 1345216..1346364 (-) | 1149 | WP_139543879.1 | RNA-guided endonuclease TnpB family protein | - |
| D4H51_RS06560 | tnpA | 1346333..1346800 (-) | 468 | WP_000063685.1 | IS200/IS605 family transposase | - |
| D4H51_RS06565 | - | 1346966..1352753 (-) | 5788 | Protein_1260 | SNF2-related protein | - |
| D4H51_RS08715 | - | 1353332..1354141 (-) | 810 | WP_341845943.1 | helicase | - |
| D4H51_RS06570 | - | 1355569..1357815 (-) | 2247 | WP_139544412.1 | type IV secretory system conjugative DNA transfer family protein | - |
| D4H51_RS06575 | - | 1357812..1358330 (-) | 519 | WP_139544413.1 | replication regulatory RepB family protein | - |
| D4H51_RS06580 | - | 1358327..1359271 (-) | 945 | WP_139544414.1 | CpaF/VirB11 family protein | - |
| D4H51_RS06585 | - | 1359276..1359548 (-) | 273 | WP_201737090.1 | hypothetical protein | - |
| D4H51_RS06590 | - | 1359566..1360524 (-) | 959 | Protein_1266 | hypothetical protein | - |
| D4H51_RS06595 | - | 1360537..1362786 (-) | 2250 | WP_139544416.1 | collagen-like protein | - |
| D4H51_RS06600 | - | 1362770..1363968 (-) | 1199 | Protein_1268 | DNA type IV secretion system protein ComB10 | - |
| D4H51_RS06605 | - | 1363965..1365632 (-) | 1668 | WP_139544417.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| D4H51_RS06610 | - | 1365629..1366798 (-) | 1170 | WP_139544418.1 | VirB8/TrbF family protein | - |
| D4H51_RS06615 | - | 1366791..1366925 (-) | 135 | WP_000738749.1 | hypothetical protein | - |
| D4H51_RS06620 | - | 1366922..1369504 (-) | 2583 | WP_139544419.1 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| D4H51_RS06625 | - | 1369504..1369740 (-) | 237 | WP_139544420.1 | hypothetical protein | - |
| D4H51_RS06630 | comB3 | 1369751..1370014 (-) | 264 | WP_128036898.1 | competence protein ComB | Machinery gene |
| D4H51_RS06635 | comB2 | 1370026..1370310 (-) | 285 | WP_000736106.1 | TrbC/VirB2 family protein | Machinery gene |
| D4H51_RS06640 | - | 1370307..1370786 (-) | 480 | WP_033749032.1 | hypothetical protein | - |
| D4H51_RS06645 | - | 1370779..1371009 (-) | 231 | WP_000189076.1 | hypothetical protein | - |
| D4H51_RS06650 | - | 1371012..1371800 (-) | 789 | WP_139544421.1 | integrase | - |
| D4H51_RS06655 | - | 1371936..1372319 (+) | 384 | WP_120957918.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 87 a.a. Molecular weight: 10018.89 Da Isoelectric Point: 5.7206
>NTDB_id=316314 D4H51_RS06630 WP_128036898.1 1369751..1370014(-) (comB3) [Helicobacter pylori strain 19-C-EK1]
MQLVGISVSNLKEISSKEKFLWLNAKSFLLSGFIPFVMIPWLDFLNSLMLYVCFLLVFSIAEFFDEDISDILIAHSKIKT
KTNSFYA
MQLVGISVSNLKEISSKEKFLWLNAKSFLLSGFIPFVMIPWLDFLNSLMLYVCFLLVFSIAEFFDEDISDILIAHSKIKT
KTNSFYA
Nucleotide
Download Length: 264 bp
>NTDB_id=316314 D4H51_RS06630 WP_128036898.1 1369751..1370014(-) (comB3) [Helicobacter pylori strain 19-C-EK1]
ATGCAATTAGTTGGTATTTCAGTTTCTAATCTCAAAGAAATCAGCTCCAAAGAAAAATTTCTTTGGCTCAATGCTAAGAG
CTTTTTACTCTCAGGATTTATTCCTTTTGTAATGATACCTTGGCTAGATTTTTTAAATTCTTTAATGCTGTATGTGTGCT
TTTTATTGGTTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGCGACATTTTAATCGCCCATTCTAAAATTAAAACC
AAAACTAATTCATTTTATGCTTAA
ATGCAATTAGTTGGTATTTCAGTTTCTAATCTCAAAGAAATCAGCTCCAAAGAAAAATTTCTTTGGCTCAATGCTAAGAG
CTTTTTACTCTCAGGATTTATTCCTTTTGTAATGATACCTTGGCTAGATTTTTTAAATTCTTTAATGCTGTATGTGTGCT
TTTTATTGGTTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGCGACATTTTAATCGCCCATTCTAAAATTAAAACC
AAAACTAATTCATTTTATGCTTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB3 | Helicobacter pylori 26695 |
59.77 |
100 |
0.598 |