Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   EZ612_RS00610 Genome accession   NZ_CP036531
Coordinates   98493..98777 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain STAB10048     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 93493..103777
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EZ612_RS00585 (EZ612_00590) - 95439..95804 (+) 366 WP_002986560.1 DUF1033 family protein -
  EZ612_RS00590 (EZ612_00595) comGA 95897..96835 (+) 939 WP_020904831.1 competence type IV pilus ATPase ComGA Machinery gene
  EZ612_RS00595 (EZ612_00600) comGB 96771..97805 (+) 1035 WP_226316548.1 competence type IV pilus assembly protein ComGB Machinery gene
  EZ612_RS00600 (EZ612_00605) comGC 97807..98133 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  EZ612_RS00605 (EZ612_00610) comGD 98108..98536 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  EZ612_RS00610 (EZ612_00615) comGE 98493..98777 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  EZ612_RS00615 (EZ612_00620) comGF 98770..99204 (+) 435 WP_020904833.1 competence type IV pilus minor pilin ComGF Machinery gene
  EZ612_RS00620 (EZ612_00625) comGG 99188..99514 (+) 327 WP_002986539.1 competence type IV pilus minor pilin ComGG -
  EZ612_RS00625 (EZ612_00630) comGH 99612..100565 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  EZ612_RS00630 (EZ612_00635) - 100624..101820 (+) 1197 WP_020904834.1 acetate kinase -
  EZ612_RS00635 (EZ612_00640) - 102007..102315 (+) 309 Protein_90 hypothetical protein -
  EZ612_RS00640 (EZ612_00645) proC 102398..103168 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=308232 EZ612_RS00610 WP_011284422.1 98493..98777(+) (comGE) [Streptococcus pyogenes strain STAB10048]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=308232 EZ612_RS00610 WP_011284422.1 98493..98777(+) (comGE) [Streptococcus pyogenes strain STAB10048]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383