Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ETT45_RS00680 Genome accession   NZ_CP035454
Coordinates   104539..104823 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain emm54     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99539..109823
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT45_RS00655 (ETT45_00655) - 101485..101850 (+) 366 WP_002986560.1 DUF1033 family protein -
  ETT45_RS00660 (ETT45_00660) comGA 101943..102881 (+) 939 WP_002993471.1 competence type IV pilus ATPase ComGA Machinery gene
  ETT45_RS00665 (ETT45_00665) comGB 102817..103851 (+) 1035 WP_225793059.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETT45_RS00670 (ETT45_00670) comGC 103853..104179 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  ETT45_RS00675 (ETT45_00675) comGD 104154..104582 (+) 429 WP_023605232.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETT45_RS00680 (ETT45_00680) comGE 104539..104823 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETT45_RS00685 (ETT45_00685) comGF 104816..105250 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  ETT45_RS00690 (ETT45_00690) comGG 105234..105560 (+) 327 WP_002992739.1 competence type IV pilus minor pilin ComGG -
  ETT45_RS00695 (ETT45_00695) comGH 105658..106611 (+) 954 WP_030126922.1 class I SAM-dependent methyltransferase Machinery gene
  ETT45_RS00700 (ETT45_00700) - 106670..107866 (+) 1197 WP_002986533.1 acetate kinase -
  ETT45_RS00705 (ETT45_00705) - 108053..108361 (+) 309 WP_011017251.1 hypothetical protein -
  ETT45_RS00710 (ETT45_00710) proC 108444..109214 (-) 771 WP_002992745.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=303425 ETT45_RS00680 WP_011284422.1 104539..104823(+) (comGE) [Streptococcus pyogenes strain emm54]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=303425 ETT45_RS00680 WP_011284422.1 104539..104823(+) (comGE) [Streptococcus pyogenes strain emm54]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTTGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383