Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ETT46_RS00680 Genome accession   NZ_CP035453
Coordinates   104559..104843 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain emm100     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99559..109843
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT46_RS00655 (ETT46_00655) - 101490..101855 (+) 366 WP_002986560.1 DUF1033 family protein -
  ETT46_RS00660 (ETT46_00660) comGA 101948..102901 (+) 954 WP_030126921.1 competence type IV pilus ATPase ComGA Machinery gene
  ETT46_RS00665 (ETT46_00665) comGB 102837..103871 (+) 1035 WP_227877282.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETT46_RS00670 (ETT46_00670) comGC 103873..104199 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  ETT46_RS00675 (ETT46_00675) comGD 104174..104602 (+) 429 WP_023605232.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETT46_RS00680 (ETT46_00680) comGE 104559..104843 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETT46_RS00685 (ETT46_00685) comGF 104836..105270 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  ETT46_RS00690 (ETT46_00690) comGG 105254..105580 (+) 327 WP_002992739.1 competence type IV pilus minor pilin ComGG -
  ETT46_RS00695 (ETT46_00695) comGH 105678..106631 (+) 954 WP_002987790.1 class I SAM-dependent methyltransferase Machinery gene
  ETT46_RS00700 (ETT46_00700) - 106690..107886 (+) 1197 WP_109821056.1 acetate kinase -
  ETT46_RS00705 (ETT46_00705) - 108073..108381 (+) 309 WP_032467031.1 hypothetical protein -
  ETT46_RS00710 (ETT46_00710) proC 108464..109234 (-) 771 WP_002992745.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=303326 ETT46_RS00680 WP_011284422.1 104559..104843(+) (comGE) [Streptococcus pyogenes strain emm100]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=303326 ETT46_RS00680 WP_011284422.1 104559..104843(+) (comGE) [Streptococcus pyogenes strain emm100]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTTGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment