Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ETT49_RS00680 Genome accession   NZ_CP035450
Coordinates   104541..104825 (+) Length   94 a.a.
NCBI ID   WP_265415267.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain emm93.4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99541..109825
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT49_RS00655 (ETT49_00655) - 101487..101852 (+) 366 WP_002986560.1 DUF1033 family protein -
  ETT49_RS00660 (ETT49_00660) comGA 101945..102883 (+) 939 WP_002993471.1 competence type IV pilus ATPase ComGA Machinery gene
  ETT49_RS00665 (ETT49_00665) comGB 102819..103853 (+) 1035 WP_225793059.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETT49_RS00670 (ETT49_00670) comGC 103855..104181 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  ETT49_RS00675 (ETT49_00675) comGD 104156..104584 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETT49_RS00680 (ETT49_00680) comGE 104541..104825 (+) 285 WP_265415267.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETT49_RS00685 (ETT49_00685) comGF 104818..105252 (+) 435 WP_020833199.1 competence type IV pilus minor pilin ComGF Machinery gene
  ETT49_RS00690 (ETT49_00690) comGG 105236..105562 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  ETT49_RS00695 (ETT49_00695) comGH 105660..106613 (+) 954 WP_136269477.1 class I SAM-dependent methyltransferase Machinery gene
  ETT49_RS00700 (ETT49_00700) - 106672..107868 (+) 1197 WP_002986533.1 acetate kinase -
  ETT49_RS00705 (ETT49_00705) - 108055..108363 (+) 309 WP_011017251.1 hypothetical protein -
  ETT49_RS00710 (ETT49_00710) proC 108446..109216 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10644.61 Da        Isoelectric Point: 8.8950

>NTDB_id=303039 ETT49_RS00680 WP_265415267.1 104541..104825(+) (comGE) [Streptococcus pyogenes strain emm93.4]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTKTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=303039 ETT49_RS00680 WP_265415267.1 104541..104825(+) (comGE) [Streptococcus pyogenes strain emm93.4]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACATACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAAAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment