Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ETT53_RS00810 Genome accession   NZ_CP035446
Coordinates   118091..118375 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain emm68.2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 113091..123375
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT53_RS00785 (ETT53_00785) - 115037..115402 (+) 366 WP_002986560.1 DUF1033 family protein -
  ETT53_RS00790 (ETT53_00790) comGA 115495..116433 (+) 939 WP_111684478.1 competence type IV pilus ATPase ComGA Machinery gene
  ETT53_RS00795 (ETT53_00795) comGB 116369..117403 (+) 1035 WP_261752453.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETT53_RS00800 (ETT53_00800) comGC 117405..117731 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  ETT53_RS00805 (ETT53_00805) comGD 117706..118134 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETT53_RS00810 (ETT53_00810) comGE 118091..118375 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETT53_RS00815 (ETT53_00815) comGF 118368..118802 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  ETT53_RS00820 (ETT53_00820) comGG 118786..119112 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  ETT53_RS00825 (ETT53_00825) comGH 119210..120163 (+) 954 WP_038433850.1 class I SAM-dependent methyltransferase Machinery gene
  ETT53_RS00830 (ETT53_00830) - 120222..121418 (+) 1197 WP_129321437.1 acetate kinase -
  ETT53_RS00835 (ETT53_00835) - 121605..121913 (+) 309 Protein_116 hypothetical protein -
  ETT53_RS00840 (ETT53_00840) proC 121996..122766 (-) 771 WP_038433852.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=302659 ETT53_RS00810 WP_011284422.1 118091..118375(+) (comGE) [Streptococcus pyogenes strain emm68.2]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=302659 ETT53_RS00810 WP_011284422.1 118091..118375(+) (comGE) [Streptococcus pyogenes strain emm68.2]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383