Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ETT59_RS00685 Genome accession   NZ_CP035440
Coordinates   104231..104515 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain emm124     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99231..109515
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT59_RS00660 (ETT59_00660) - 101177..101542 (+) 366 WP_002986560.1 DUF1033 family protein -
  ETT59_RS00665 (ETT59_00665) comGA 101635..102573 (+) 939 WP_023612548.1 competence type IV pilus ATPase ComGA Machinery gene
  ETT59_RS00670 (ETT59_00670) comGB 102509..103543 (+) 1035 WP_227878117.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETT59_RS00675 (ETT59_00675) comGC 103545..103871 (+) 327 WP_136276522.1 competence type IV pilus major pilin ComGC Machinery gene
  ETT59_RS00680 (ETT59_00680) comGD 103846..104274 (+) 429 WP_136276529.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETT59_RS00685 (ETT59_00685) comGE 104231..104515 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETT59_RS00690 (ETT59_00690) comGF 104508..104942 (+) 435 WP_111711329.1 competence type IV pilus minor pilin ComGF Machinery gene
  ETT59_RS00695 (ETT59_00695) comGG 104926..105252 (+) 327 WP_136276521.1 competence type IV pilus minor pilin ComGG -
  ETT59_RS00700 (ETT59_00700) comGH 105350..106303 (+) 954 WP_009880357.1 class I SAM-dependent methyltransferase Machinery gene
  ETT59_RS00705 (ETT59_00705) - 106362..107558 (+) 1197 WP_010921803.1 acetate kinase -
  ETT59_RS00710 (ETT59_00710) - 107745..108053 (+) 309 WP_011284425.1 hypothetical protein -
  ETT59_RS00715 (ETT59_00715) proC 108136..108906 (-) 771 WP_136306009.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=302091 ETT59_RS00685 WP_011284422.1 104231..104515(+) (comGE) [Streptococcus pyogenes strain emm124]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=302091 ETT59_RS00685 WP_011284422.1 104231..104515(+) (comGE) [Streptococcus pyogenes strain emm124]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGTAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment