Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ETT61_RS00750 Genome accession   NZ_CP035438
Coordinates   115447..115731 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain emm22.8     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 110447..120731
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT61_RS00725 (ETT61_00725) - 112394..112759 (+) 366 WP_002986560.1 DUF1033 family protein -
  ETT61_RS00730 (ETT61_00730) comGA 112852..113790 (+) 939 WP_023079010.1 competence type IV pilus ATPase ComGA Machinery gene
  ETT61_RS00735 (ETT61_00735) comGB 113726..114760 (+) 1035 WP_231871599.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETT61_RS00740 (ETT61_00740) comGC 114762..115088 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  ETT61_RS00745 (ETT61_00745) comGD 115063..115490 (+) 428 Protein_98 competence type IV pilus minor pilin ComGD -
  ETT61_RS00750 (ETT61_00750) comGE 115447..115731 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETT61_RS00755 (ETT61_00755) comGF 115724..116158 (+) 435 WP_136020264.1 competence type IV pilus minor pilin ComGF Machinery gene
  ETT61_RS00760 (ETT61_00760) comGG 116142..116468 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  ETT61_RS00765 (ETT61_00765) comGH 116566..117519 (+) 954 WP_136020265.1 class I SAM-dependent methyltransferase Machinery gene
  ETT61_RS00770 (ETT61_00770) - 117578..118774 (+) 1197 WP_010921803.1 acetate kinase -
  ETT61_RS00775 (ETT61_00775) - 118960..119268 (+) 309 WP_030126458.1 hypothetical protein -
  ETT61_RS00780 (ETT61_00780) proC 119351..120121 (-) 771 WP_136020266.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=301898 ETT61_RS00750 WP_002987779.1 115447..115731(+) (comGE) [Streptococcus pyogenes strain emm22.8]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=301898 ETT61_RS00750 WP_002987779.1 115447..115731(+) (comGE) [Streptococcus pyogenes strain emm22.8]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGTAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment