Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ETT66_RS00705 Genome accession   NZ_CP035433
Coordinates   107974..108258 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain emm65     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 102974..113258
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT66_RS00680 (ETT66_00680) - 104920..105285 (+) 366 WP_002986560.1 DUF1033 family protein -
  ETT66_RS00685 (ETT66_00685) comGA 105378..106316 (+) 939 WP_063812149.1 competence type IV pilus ATPase ComGA Machinery gene
  ETT66_RS00690 (ETT66_00690) comGB 106252..107286 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETT66_RS00695 (ETT66_00695) comGC 107288..107614 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  ETT66_RS00700 (ETT66_00700) comGD 107589..108017 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETT66_RS00705 (ETT66_00705) comGE 107974..108258 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETT66_RS00710 (ETT66_00710) comGF 108251..108685 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  ETT66_RS00715 (ETT66_00715) comGG 108669..108995 (+) 327 WP_136113455.1 competence type IV pilus minor pilin ComGG -
  ETT66_RS00720 (ETT66_00720) comGH 109093..110046 (+) 954 WP_136026380.1 class I SAM-dependent methyltransferase Machinery gene
  ETT66_RS00725 (ETT66_00725) - 110105..111301 (+) 1197 WP_002987791.1 acetate kinase -
  ETT66_RS00730 (ETT66_00730) - 111488..111796 (+) 309 WP_010921804.1 hypothetical protein -
  ETT66_RS00735 (ETT66_00735) proC 111879..112649 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=301433 ETT66_RS00705 WP_011284422.1 107974..108258(+) (comGE) [Streptococcus pyogenes strain emm65]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=301433 ETT66_RS00705 WP_011284422.1 107974..108258(+) (comGE) [Streptococcus pyogenes strain emm65]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment