Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ETK71_RS12455 Genome accession   NZ_CP035411
Coordinates   2422389..2422772 (-) Length   127 a.a.
NCBI ID   WP_041850015.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103622     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2417389..2427772
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETK71_RS12415 (ETK71_12415) sinI 2418323..2418496 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ETK71_RS12420 (ETK71_12420) sinR 2418530..2418865 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ETK71_RS12425 (ETK71_12425) tasA 2418958..2419743 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  ETK71_RS12430 (ETK71_12430) sipW 2419807..2420379 (-) 573 WP_003246088.1 signal peptidase I SipW -
  ETK71_RS12435 (ETK71_12435) tapA 2420363..2421124 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  ETK71_RS12440 (ETK71_12440) yqzG 2421396..2421722 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ETK71_RS12445 (ETK71_12445) spoIITA 2421764..2421943 (-) 180 WP_003230176.1 YqzE family protein -
  ETK71_RS12450 (ETK71_12450) comGG 2422014..2422388 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  ETK71_RS12455 (ETK71_12455) comGF 2422389..2422772 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  ETK71_RS12460 (ETK71_12460) comGE 2422798..2423145 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  ETK71_RS12465 (ETK71_12465) comGD 2423129..2423560 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  ETK71_RS12470 (ETK71_12470) comGC 2423550..2423846 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ETK71_RS12475 (ETK71_12475) comGB 2423860..2424897 (-) 1038 WP_041850016.1 comG operon protein ComGB Machinery gene
  ETK71_RS12480 (ETK71_12480) comGA 2424884..2425954 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ETK71_RS12490 (ETK71_12490) corA 2426365..2427318 (-) 954 WP_029317911.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14250.41 Da        Isoelectric Point: 6.4838

>NTDB_id=300394 ETK71_RS12455 WP_041850015.1 2422389..2422772(-) (comGF) [Bacillus subtilis strain SRCM103622]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHIAAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=300394 ETK71_RS12455 WP_041850015.1 2422389..2422772(-) (comGF) [Bacillus subtilis strain SRCM103622]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984