Detailed information
Bioinformatically predicted
Overview
| Name | comFC | Type | Machinery gene |
| Locus tag | C0W45_RS07540 | Genome accession | NZ_CP029966 |
| Coordinates | 1441445..1441975 (-) | Length | 176 a.a. |
| NCBI ID | WP_155275694.1 | Uniprot ID | - |
| Organism | Latilactobacillus curvatus strain ZJUNIT8 | ||
| Function | ssDNA transport into the cell (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1379814..1460894 | 1441445..1441975 | within | 0 |
Gene organization within MGE regions
Location: 1379814..1460894
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C0W45_RS10420 | - | 1379954..1380109 (-) | 156 | WP_239494179.1 | DUF6506 family protein | - |
| C0W45_RS07240 (C0W45_07240) | - | 1380347..1380952 (-) | 606 | WP_076787867.1 | response regulator transcription factor | - |
| C0W45_RS07245 (C0W45_07245) | - | 1380949..1382073 (-) | 1125 | WP_111447800.1 | sensor histidine kinase | - |
| C0W45_RS07250 (C0W45_07250) | - | 1382070..1382816 (-) | 747 | WP_111447801.1 | ABC transporter permease | - |
| C0W45_RS07255 (C0W45_07255) | - | 1382820..1383692 (-) | 873 | WP_081038337.1 | ABC transporter ATP-binding protein | - |
| C0W45_RS07260 (C0W45_07260) | - | 1383835..1384476 (+) | 642 | WP_056966841.1 | DNA-3-methyladenine glycosylase | - |
| C0W45_RS07265 (C0W45_07265) | - | 1384563..1385681 (+) | 1119 | WP_111447802.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| C0W45_RS10270 | - | 1385716..1385883 (-) | 168 | WP_004265902.1 | hypothetical protein | - |
| C0W45_RS07270 (C0W45_07270) | - | 1385957..1386811 (+) | 855 | WP_052202678.1 | helix-turn-helix transcriptional regulator | - |
| C0W45_RS07275 (C0W45_07275) | - | 1386988..1387725 (-) | 738 | WP_111447803.1 | zinc-binding dehydrogenase | - |
| C0W45_RS07280 (C0W45_07280) | - | 1387953..1388336 (-) | 384 | WP_111447804.1 | hypothetical protein | - |
| C0W45_RS07285 (C0W45_07285) | - | 1388447..1389388 (-) | 942 | WP_204354399.1 | nucleoside hydrolase | - |
| C0W45_RS07290 (C0W45_07290) | - | 1389538..1390509 (-) | 972 | WP_111447806.1 | LacI family DNA-binding transcriptional regulator | - |
| C0W45_RS10645 | - | 1390523..1390813 (-) | 291 | WP_232505343.1 | fibronectin type III-like domain-contianing protein | - |
| C0W45_RS10540 | - | 1390910..1391973 (-) | 1064 | Protein_1424 | glycoside hydrolase family 3 C-terminal domain-containing protein | - |
| C0W45_RS10435 | - | 1391934..1392803 (-) | 870 | WP_275426056.1 | glycoside hydrolase family 3 N-terminal domain-containing protein | - |
| C0W45_RS07300 (C0W45_07300) | - | 1392814..1394130 (-) | 1317 | Protein_1426 | PTS sugar transporter subunit IIC | - |
| C0W45_RS07305 (C0W45_07305) | clpP | 1394739..1395323 (+) | 585 | WP_004265909.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | - |
| C0W45_RS07310 (C0W45_07310) | - | 1395445..1395963 (+) | 519 | WP_111447807.1 | DsbA family protein | - |
| C0W45_RS07315 (C0W45_07315) | - | 1396068..1396523 (-) | 456 | WP_111447808.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| C0W45_RS07320 (C0W45_07320) | whiA | 1396614..1397558 (-) | 945 | WP_004265894.1 | DNA-binding protein WhiA | - |
| C0W45_RS07325 (C0W45_07325) | - | 1397561..1398595 (-) | 1035 | WP_039098449.1 | gluconeogenesis factor YvcK family protein | - |
| C0W45_RS07330 (C0W45_07330) | rapZ | 1398592..1399476 (-) | 885 | WP_004265984.1 | RNase adapter RapZ | - |
| C0W45_RS07335 (C0W45_07335) | - | 1399678..1400214 (-) | 537 | WP_004265944.1 | HdeD family acid-resistance protein | - |
| C0W45_RS07340 (C0W45_07340) | uvrA | 1400369..1403221 (-) | 2853 | WP_111447809.1 | excinuclease ABC subunit UvrA | - |
| C0W45_RS07345 (C0W45_07345) | uvrB | 1403234..1405237 (-) | 2004 | WP_004265948.1 | excinuclease ABC subunit UvrB | - |
| C0W45_RS07350 (C0W45_07350) | - | 1405654..1406286 (-) | 633 | WP_004265951.1 | YfbR-like 5'-deoxynucleotidase | - |
| C0W45_RS07355 (C0W45_07355) | - | 1406399..1408123 (-) | 1725 | WP_056966225.1 | phospho-sugar mutase | - |
| C0W45_RS07360 (C0W45_07360) | trxB | 1408502..1409422 (-) | 921 | WP_111447810.1 | thioredoxin-disulfide reductase | - |
| C0W45_RS07365 (C0W45_07365) | - | 1409510..1409920 (-) | 411 | WP_039099209.1 | hypothetical protein | - |
| C0W45_RS07370 (C0W45_07370) | - | 1410032..1411060 (-) | 1029 | WP_111447811.1 | NAD(P)H-dependent glycerol-3-phosphate dehydrogenase | - |
| C0W45_RS07375 (C0W45_07375) | lgt | 1411088..1411921 (-) | 834 | WP_111447812.1 | prolipoprotein diacylglyceryl transferase | - |
| C0W45_RS07380 (C0W45_07380) | hprK | 1412288..1413229 (-) | 942 | WP_004265923.1 | HPr(Ser) kinase/phosphatase | - |
| C0W45_RS07385 (C0W45_07385) | - | 1413521..1414441 (+) | 921 | WP_011373852.1 | IS30-like element ISLsa1 family transposase | - |
| C0W45_RS07390 (C0W45_07390) | - | 1414455..1414913 (+) | 459 | Protein_1444 | IS30-like element ISLpl1 family transposase | - |
| C0W45_RS07395 (C0W45_07395) | - | 1414941..1415528 (+) | 588 | WP_111447813.1 | site-specific integrase | - |
| C0W45_RS07400 (C0W45_07400) | - | 1415541..1415774 (+) | 234 | Protein_1446 | hypothetical protein | - |
| C0W45_RS10545 | - | 1416076..1416210 (-) | 135 | WP_273960253.1 | hypothetical protein | - |
| C0W45_RS07410 (C0W45_07410) | - | 1416307..1416978 (-) | 672 | WP_111447815.1 | hypothetical protein | - |
| C0W45_RS07415 (C0W45_07415) | - | 1416996..1417838 (-) | 843 | WP_111447816.1 | class C sortase | - |
| C0W45_RS07420 (C0W45_07420) | - | 1417841..1419748 (-) | 1908 | WP_111447817.1 | pilin N-terminal domain-containing protein | - |
| C0W45_RS07425 (C0W45_07425) | - | 1419745..1420434 (-) | 690 | WP_111447818.1 | class A sortase | - |
| C0W45_RS07430 (C0W45_07430) | - | 1420444..1422135 (-) | 1692 | WP_111447819.1 | hypothetical protein | - |
| C0W45_RS07435 (C0W45_07435) | - | 1422304..1423182 (+) | 879 | WP_003561820.1 | IS982-like element ISLpl4 family transposase | - |
| C0W45_RS07440 (C0W45_07440) | - | 1423245..1423391 (+) | 147 | Protein_1454 | IS3 family transposase | - |
| C0W45_RS07445 (C0W45_07445) | - | 1423445..1423798 (-) | 354 | WP_004265953.1 | phage holin family protein | - |
| C0W45_RS07450 (C0W45_07450) | - | 1423798..1424097 (-) | 300 | WP_056966835.1 | hypothetical protein | - |
| C0W45_RS07455 (C0W45_07455) | - | 1424097..1424330 (-) | 234 | WP_035186190.1 | PspC domain-containing protein | - |
| C0W45_RS07460 (C0W45_07460) | liaX | 1424358..1425812 (-) | 1455 | WP_004265927.1 | daptomycin-sensing surface protein LiaX | - |
| C0W45_RS07465 (C0W45_07465) | - | 1425983..1426453 (-) | 471 | WP_004270223.1 | nucleoside 2-deoxyribosyltransferase | - |
| C0W45_RS07470 (C0W45_07470) | phoU | 1426528..1427205 (-) | 678 | WP_039099339.1 | phosphate signaling complex protein PhoU | - |
| C0W45_RS07475 (C0W45_07475) | pstB | 1427224..1427982 (-) | 759 | WP_004270242.1 | phosphate ABC transporter ATP-binding protein PstB | - |
| C0W45_RS07480 (C0W45_07480) | pstB | 1428003..1428812 (-) | 810 | WP_004270235.1 | phosphate ABC transporter ATP-binding protein PstB | - |
| C0W45_RS07485 (C0W45_07485) | pstA | 1428822..1429706 (-) | 885 | WP_004270246.1 | phosphate ABC transporter permease PstA | - |
| C0W45_RS07490 (C0W45_07490) | pstC | 1429706..1430629 (-) | 924 | WP_004270247.1 | phosphate ABC transporter permease subunit PstC | - |
| C0W45_RS07495 (C0W45_07495) | - | 1430640..1431500 (-) | 861 | WP_065825893.1 | phosphate ABC transporter substrate-binding protein PstS family protein | - |
| C0W45_RS07500 (C0W45_07500) | pnpS | 1431595..1433256 (-) | 1662 | WP_111447820.1 | two-component system histidine kinase PnpS | - |
| C0W45_RS07505 (C0W45_07505) | - | 1433243..1433956 (-) | 714 | WP_004270257.1 | response regulator transcription factor | - |
| C0W45_RS07510 (C0W45_07510) | - | 1433977..1435107 (-) | 1131 | WP_239494226.1 | PDZ domain-containing protein | - |
| C0W45_RS07515 (C0W45_07515) | ftsX | 1435300..1436187 (-) | 888 | WP_004270230.1 | permease-like cell division protein FtsX | - |
| C0W45_RS07520 (C0W45_07520) | ftsE | 1436177..1436854 (-) | 678 | WP_371857627.1 | cell division ATP-binding protein FtsE | - |
| C0W45_RS07530 (C0W45_07530) | secA | 1438182..1440545 (-) | 2364 | WP_004270228.1 | preprotein translocase subunit SecA | - |
| C0W45_RS07535 (C0W45_07535) | hpf | 1440774..1441319 (-) | 546 | WP_004270226.1 | ribosome hibernation-promoting factor, HPF/YfiA family | - |
| C0W45_RS07540 (C0W45_07540) | comFC | 1441445..1441975 (-) | 531 | WP_155275694.1 | ComF family protein | Machinery gene |
| C0W45_RS07545 (C0W45_07545) | comFA | 1442119..1443453 (-) | 1335 | WP_239494181.1 | DEAD/DEAH box helicase | Machinery gene |
| C0W45_RS07550 (C0W45_07550) | - | 1443510..1444172 (+) | 663 | WP_004270231.1 | YigZ family protein | - |
| C0W45_RS07555 (C0W45_07555) | - | 1444197..1445285 (-) | 1089 | WP_111447955.1 | glycosyltransferase family 4 protein | - |
| C0W45_RS07560 (C0W45_07560) | hemH | 1445395..1446346 (-) | 952 | Protein_1478 | ferrochelatase | - |
| C0W45_RS07565 (C0W45_07565) | rny | 1446346..1447908 (-) | 1563 | WP_004270250.1 | ribonuclease Y | - |
| C0W45_RS07570 (C0W45_07570) | recA | 1448152..1449210 (-) | 1059 | WP_004270239.1 | recombinase RecA | Machinery gene |
| C0W45_RS07575 (C0W45_07575) | pgsA | 1449402..1449986 (-) | 585 | WP_004270254.1 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase | - |
| C0W45_RS07580 (C0W45_07580) | - | 1450009..1450932 (-) | 924 | WP_111447824.1 | helix-turn-helix domain-containing protein | - |
| C0W45_RS07585 (C0W45_07585) | ymfI | 1451015..1451743 (-) | 729 | WP_004270241.1 | elongation factor P 5-aminopentanone reductase | - |
| C0W45_RS07590 (C0W45_07590) | yfmH | 1451736..1453046 (-) | 1311 | WP_111447825.1 | EF-P 5-aminopentanol modification-associated protein YfmH | - |
| C0W45_RS07595 (C0W45_07595) | yfmF | 1453036..1454307 (-) | 1272 | WP_004270245.1 | EF-P 5-aminopentanol modification-associated protein YfmF | - |
| C0W45_RS07600 (C0W45_07600) | - | 1454509..1455183 (+) | 675 | WP_111447826.1 | helix-turn-helix domain-containing protein | - |
| C0W45_RS07605 (C0W45_07605) | - | 1455180..1456073 (+) | 894 | WP_035187177.1 | IS3 family transposase | - |
| C0W45_RS07610 (C0W45_07610) | - | 1456259..1458607 (-) | 2349 | WP_111447827.1 | FtsK/SpoIIIE family DNA translocase | - |
| C0W45_RS07615 (C0W45_07615) | - | 1458749..1459150 (-) | 402 | WP_111447828.1 | DUF1149 family protein | - |
| C0W45_RS07620 (C0W45_07620) | trmL | 1459163..1459672 (-) | 510 | WP_004270256.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| C0W45_RS07625 (C0W45_07625) | - | 1459926..1460759 (-) | 834 | WP_056965972.1 | methyltransferase domain-containing protein | - |
Sequence
Protein
Download Length: 176 a.a. Molecular weight: 20695.83 Da Isoelectric Point: 9.7337
>NTDB_id=297972 C0W45_RS07540 WP_155275694.1 1441445..1441975(-) (comFC) [Latilactobacillus curvatus strain ZJUNIT8]
MTTQGVCPDCQRWQQLYPGEQFTNRALLTYNEPMQQYFQRYKGQGDYRLRHVFQRLIRENFPVQRQTAYIPVPTDPTHLQ
SRGFNPVVGLYEDCFPLTPLLQKLPTEKGQAQKNRAERLATPQFFKCAQNMLLGSKVQQLILLDDIYTTGRTLWHAQQCL
RKRYQTLPIHAITLVH
MTTQGVCPDCQRWQQLYPGEQFTNRALLTYNEPMQQYFQRYKGQGDYRLRHVFQRLIRENFPVQRQTAYIPVPTDPTHLQ
SRGFNPVVGLYEDCFPLTPLLQKLPTEKGQAQKNRAERLATPQFFKCAQNMLLGSKVQQLILLDDIYTTGRTLWHAQQCL
RKRYQTLPIHAITLVH
Nucleotide
Download Length: 531 bp
>NTDB_id=297972 C0W45_RS07540 WP_155275694.1 1441445..1441975(-) (comFC) [Latilactobacillus curvatus strain ZJUNIT8]
ATGACAACCCAGGGGGTGTGTCCGGATTGCCAGAGATGGCAGCAACTGTATCCAGGCGAACAATTTACTAATCGAGCGTT
GTTAACATACAACGAACCAATGCAACAGTATTTTCAACGCTATAAGGGGCAGGGGGATTATCGATTACGTCACGTATTTC
AACGGCTGATTCGAGAAAATTTTCCTGTGCAACGGCAAACGGCGTATATCCCAGTCCCGACTGATCCAACACATTTGCAA
AGCCGCGGATTCAATCCGGTGGTTGGCTTATACGAGGACTGTTTTCCACTGACCCCATTGTTGCAGAAGCTACCAACTGA
AAAAGGACAAGCACAAAAAAATCGTGCAGAGCGCTTAGCAACGCCGCAATTTTTTAAATGCGCGCAGAACATGCTGTTGG
GTTCCAAGGTGCAGCAGTTAATTTTGTTGGATGATATTTATACCACTGGGCGCACGTTATGGCATGCTCAGCAGTGTCTC
CGCAAGCGATACCAAACGCTGCCAATTCACGCAATTACTTTAGTCCACTAG
ATGACAACCCAGGGGGTGTGTCCGGATTGCCAGAGATGGCAGCAACTGTATCCAGGCGAACAATTTACTAATCGAGCGTT
GTTAACATACAACGAACCAATGCAACAGTATTTTCAACGCTATAAGGGGCAGGGGGATTATCGATTACGTCACGTATTTC
AACGGCTGATTCGAGAAAATTTTCCTGTGCAACGGCAAACGGCGTATATCCCAGTCCCGACTGATCCAACACATTTGCAA
AGCCGCGGATTCAATCCGGTGGTTGGCTTATACGAGGACTGTTTTCCACTGACCCCATTGTTGCAGAAGCTACCAACTGA
AAAAGGACAAGCACAAAAAAATCGTGCAGAGCGCTTAGCAACGCCGCAATTTTTTAAATGCGCGCAGAACATGCTGTTGG
GTTCCAAGGTGCAGCAGTTAATTTTGTTGGATGATATTTATACCACTGGGCGCACGTTATGGCATGCTCAGCAGTGTCTC
CGCAAGCGATACCAAACGCTGCCAATTCACGCAATTACTTTAGTCCACTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comFC | Latilactobacillus sakei subsp. sakei 23K |
65.493 |
80.682 |
0.528 |