Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   EGC57_RS00680 Genome accession   NZ_CP033621
Coordinates   104629..104913 (+) Length   94 a.a.
NCBI ID   WP_307777288.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain M75     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99629..109913
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EGC57_RS00655 (EGC57_00655) - 101575..101940 (+) 366 WP_002986560.1 DUF1033 family protein -
  EGC57_RS00660 (EGC57_00660) comGA 102033..102971 (+) 939 WP_002986557.1 competence type IV pilus ATPase ComGA Machinery gene
  EGC57_RS00665 (EGC57_00665) comGB 102907..103941 (+) 1035 WP_228631569.1 competence type IV pilus assembly protein ComGB Machinery gene
  EGC57_RS00670 (EGC57_00670) comGC 103943..104269 (+) 327 WP_011528161.1 competence type IV pilus major pilin ComGC Machinery gene
  EGC57_RS00675 (EGC57_00675) comGD 104244..104672 (+) 429 WP_076639399.1 competence type IV pilus minor pilin ComGD Machinery gene
  EGC57_RS00680 (EGC57_00680) comGE 104629..104913 (+) 285 WP_307777288.1 competence type IV pilus minor pilin ComGE Machinery gene
  EGC57_RS00685 (EGC57_00685) comGF 104906..105340 (+) 435 WP_002986542.1 competence type IV pilus minor pilin ComGF Machinery gene
  EGC57_RS00690 (EGC57_00690) comGG 105324..105650 (+) 327 WP_002986539.1 competence type IV pilus minor pilin ComGG -
  EGC57_RS00695 (EGC57_00695) comGH 105748..106701 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  EGC57_RS00700 (EGC57_00700) - 106760..107956 (+) 1197 WP_020904834.1 acetate kinase -
  EGC57_RS00705 (EGC57_00705) - 108143..108451 (+) 309 Protein_88 hypothetical protein -
  EGC57_RS00710 (EGC57_00710) proC 108534..109304 (-) 771 WP_076639397.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10700.68 Da        Isoelectric Point: 8.9043

>NTDB_id=283908 EGC57_RS00680 WP_307777288.1 104629..104913(+) (comGE) [Streptococcus pyogenes strain M75]
MGIIKKQVKAYIVLESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=283908 EGC57_RS00680 WP_307777288.1 104629..104913(+) (comGE) [Streptococcus pyogenes strain M75]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGTCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAT
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383