Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   C7M19_RS03450 Genome accession   NZ_CP028205
Coordinates   781467..781733 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM102741     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 776467..786733
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M19_RS03400 (C7M19_00697) sinR 776631..776966 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  C7M19_RS03405 (C7M19_00698) tasA 777014..777799 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  C7M19_RS03410 (C7M19_00699) sipW 777864..778448 (-) 585 WP_160223172.1 signal peptidase I SipW -
  C7M19_RS03415 (C7M19_00700) tapA 778420..779091 (-) 672 WP_160223173.1 amyloid fiber anchoring/assembly protein TapA -
  C7M19_RS03420 (C7M19_00701) - 779350..779679 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  C7M19_RS03425 (C7M19_00702) - 779719..779898 (-) 180 WP_160223174.1 YqzE family protein -
  C7M19_RS03430 (C7M19_00703) comGG 779955..780332 (-) 378 WP_160223175.1 competence type IV pilus minor pilin ComGG Machinery gene
  C7M19_RS03435 (C7M19_00704) comGF 780333..780833 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  C7M19_RS03440 (C7M19_00705) comGE 780742..781056 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  C7M19_RS03445 (C7M19_00706) comGD 781040..781477 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  C7M19_RS03450 (C7M19_00707) comGC 781467..781733 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  C7M19_RS03455 (C7M19_00708) comGB 781780..782817 (-) 1038 WP_061582071.1 competence type IV pilus assembly protein ComGB Machinery gene
  C7M19_RS03460 (C7M19_00709) comGA 782804..783874 (-) 1071 WP_043020785.1 competence type IV pilus ATPase ComGA Machinery gene
  C7M19_RS03465 (C7M19_00710) - 784071..785021 (-) 951 WP_160223176.1 magnesium transporter CorA family protein -
  C7M19_RS03470 (C7M19_00711) - 785167..786468 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=282542 C7M19_RS03450 WP_042635730.1 781467..781733(-) (comGC) [Bacillus velezensis strain SRCM102741]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=282542 C7M19_RS03450 WP_042635730.1 781467..781733(-) (comGC) [Bacillus velezensis strain SRCM102741]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAGGGCTGTGAAGGACTGCAGAATATGGTGAAAGCTCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAAAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment