Detailed information    

insolico Bioinformatically predicted

Overview


Name   amiF   Type   Regulator
Locus tag   CR922_RS02625 Genome accession   NZ_CP025400
Coordinates   490478..491407 (+) Length   309 a.a.
NCBI ID   WP_002951426.1    Uniprot ID   A0A7U7CIU5
Organism   Streptococcus thermophilus strain EPS     
Function   internalize XIP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 435166..506941 490478..491407 within 0


Gene organization within MGE regions


Location: 435166..506941
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CR922_RS02355 - 435264..436004 (-) 741 WP_002945131.1 amino acid ABC transporter ATP-binding protein -
  CR922_RS02360 - 436004..438214 (-) 2211 WP_011226350.1 ABC transporter substrate-binding protein/permease -
  CR922_RS10725 - 438413..439349 (+) 937 Protein_411 CPBP family intramembrane glutamic endopeptidase -
  CR922_RS02375 uvrB 440036..442027 (+) 1992 WP_002953358.1 excinuclease ABC subunit UvrB -
  CR922_RS02380 - 442072..442536 (+) 465 WP_011226345.1 8-oxo-dGTP diphosphatase -
  CR922_RS02385 - 442750..443580 (+) 831 WP_041828297.1 transporter substrate-binding domain-containing protein -
  CR922_RS02390 - 443577..444374 (+) 798 WP_059257394.1 transporter substrate-binding domain-containing protein -
  CR922_RS02395 - 444721..445830 (+) 1110 WP_041828295.1 aminotransferase -
  CR922_RS02400 - 445923..446717 (+) 795 WP_011227442.1 ABC transporter substrate-binding protein -
  CR922_RS02405 - 446823..447773 (-) 951 WP_101361239.1 IS30 family transposase -
  CR922_RS02410 rpsU 448154..448330 (+) 177 WP_011226340.1 30S ribosomal protein S21 -
  CR922_RS02420 dnaG 448702..450513 (+) 1812 WP_011227441.1 DNA primase -
  CR922_RS02425 rpoD 450517..451626 (+) 1110 WP_011227440.1 RNA polymerase sigma factor RpoD -
  CR922_RS02430 - 451680..452015 (+) 336 WP_002891474.1 metal-sulfur cluster assembly factor -
  CR922_RS02435 - 452025..452951 (+) 927 WP_011227439.1 glycosyltransferase family 2 protein -
  CR922_RS02440 rfbD 453069..453920 (+) 852 WP_014621820.1 dTDP-4-dehydrorhamnose reductase -
  CR922_RS02445 - 454041..455300 (+) 1260 WP_011227438.1 oligosaccharide flippase family protein -
  CR922_RS02450 - 455297..456283 (+) 987 WP_011227437.1 glycosyltransferase family 2 protein -
  CR922_RS02455 - 456348..456820 (+) 473 Protein_427 glycosyltransferase family 2 protein -
  CR922_RS02460 - 456904..457599 (+) 696 WP_173405413.1 glycosyltransferase family 2 protein -
  CR922_RS02465 - 457605..457937 (+) 333 WP_011227433.1 DUF2304 domain-containing protein -
  CR922_RS02470 - 457938..458720 (+) 783 WP_011227432.1 glycosyltransferase family A protein -
  CR922_RS02475 cps2T 458839..459987 (+) 1149 WP_101361240.1 beta 1-4 rhamnosyltransferase Cps2T -
  CR922_RS02480 - 459984..460925 (+) 942 WP_101361241.1 glycosyltransferase family 2 protein -
  CR922_RS02485 - 460925..461731 (+) 807 WP_011227429.1 ABC transporter permease -
  CR922_RS02490 - 461731..462933 (+) 1203 WP_059257395.1 ABC transporter ATP-binding protein -
  CR922_RS02495 - 462951..464651 (+) 1701 WP_041827077.1 glycosyltransferase family 4 protein -
  CR922_RS02500 - 464653..466398 (+) 1746 WP_011227426.1 rhamnan synthesis F family protein -
  CR922_RS02505 - 466547..467887 (+) 1341 WP_231108743.1 DUF2142 domain-containing protein -
  CR922_RS02510 radC 468066..468752 (+) 687 WP_011227424.1 RadC family protein -
  CR922_RS02515 - 468805..469500 (-) 696 WP_011227423.1 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein -
  CR922_RS02520 - 469493..470152 (-) 660 WP_041827076.1 redox-sensing transcriptional repressor Rex -
  CR922_RS02525 - 470296..470643 (-) 348 WP_002948028.1 DUF1831 domain-containing protein -
  CR922_RS02530 - 470645..471757 (-) 1113 WP_002948029.1 cysteine desulfurase family protein -
  CR922_RS02535 - 471761..472732 (-) 972 WP_101361242.1 ribose-phosphate diphosphokinase -
  CR922_RS02540 - 473095..473670 (-) 576 WP_002951444.1 CYTH domain-containing protein -
  CR922_RS02545 - 473766..474440 (+) 675 WP_101361243.1 GTP pyrophosphokinase -
  CR922_RS02550 - 474412..475248 (+) 837 WP_041827075.1 NAD kinase -
  CR922_RS02555 - 475245..476141 (+) 897 WP_011226316.1 RluA family pseudouridine synthase -
  CR922_RS02560 pta 476155..477138 (+) 984 WP_011227420.1 phosphate acetyltransferase -
  CR922_RS02565 - 477224..478575 (+) 1352 Protein_449 IS3 family transposase -
  CR922_RS02570 - 478621..479826 (-) 1206 WP_011227415.1 OFA family MFS transporter -
  CR922_RS02575 - 480175..480489 (+) 315 Protein_451 TatD family hydrolase -
  CR922_RS10170 - 480521..480931 (+) 411 Protein_452 ATP-binding cassette domain-containing protein -
  CR922_RS02590 - 480925..481115 (+) 191 Protein_453 IS3 family transposase -
  CR922_RS02595 amiA3 481319..483292 (+) 1974 WP_101361244.1 peptide ABC transporter substrate-binding protein Regulator
  CR922_RS02600 - 483337..484586 (-) 1250 Protein_455 ISL3 family transposase -
  CR922_RS02605 amiA 484942..486909 (+) 1968 WP_011226784.1 peptide ABC transporter substrate-binding protein Regulator
  CR922_RS02610 amiC 486971..488464 (+) 1494 WP_011227407.1 ABC transporter permease Regulator
  CR922_RS02615 amiD 488464..489390 (+) 927 WP_002946409.1 oligopeptide ABC transporter permease OppC Regulator
  CR922_RS02620 amiE 489400..490485 (+) 1086 WP_011226304.1 ABC transporter ATP-binding protein Regulator
  CR922_RS02625 amiF 490478..491407 (+) 930 WP_002951426.1 ATP-binding cassette domain-containing protein Regulator
  CR922_RS02630 - 491457..492242 (-) 786 WP_002951425.1 hypothetical protein -
  CR922_RS02635 - 492254..492952 (-) 699 WP_011226301.1 ABC transporter ATP-binding protein -
  CR922_RS02640 - 492957..493334 (-) 378 WP_011226300.1 GntR family transcriptional regulator -
  CR922_RS02645 - 493517..494311 (+) 795 WP_059257398.1 HAD hydrolase family protein -
  CR922_RS02650 - 494304..495119 (+) 816 WP_011227405.1 Cof-type HAD-IIB family hydrolase -
  CR922_RS02655 ftsY 495133..496524 (+) 1392 WP_011226297.1 signal recognition particle-docking protein FtsY -
  CR922_RS02660 gmk 496757..497386 (+) 630 WP_011226296.1 guanylate kinase -
  CR922_RS02665 rpoZ 497408..497722 (+) 315 WP_002951415.1 DNA-directed RNA polymerase subunit omega -
  CR922_RS02670 - 497864..500260 (+) 2397 WP_011227404.1 primosomal protein N' -
  CR922_RS02675 fmt 500278..501213 (+) 936 WP_002951411.1 methionyl-tRNA formyltransferase -
  CR922_RS02680 rsmB 501203..502525 (+) 1323 WP_014608533.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  CR922_RS02685 - 502569..503306 (+) 738 WP_101361246.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  CR922_RS02690 stkP/pknB 503306..505177 (+) 1872 WP_101361247.1 Stk1 family PASTA domain-containing Ser/Thr kinase Regulator
  CR922_RS10175 - 505814..505969 (+) 156 WP_011226290.1 ion channel -
  CR922_RS02700 liaF 506235..506933 (+) 699 WP_011226289.1 cell wall-active antibiotics response protein LiaF -

Sequence


Protein


Download         Length: 309 a.a.        Molecular weight: 35171.28 Da        Isoelectric Point: 6.5989

>NTDB_id=260979 CR922_RS02625 WP_002951426.1 490478..491407(+) (amiF) [Streptococcus thermophilus strain EPS]
MPEKLVEVKDVEISFGEGRKKFVAVHNANFFINKGETFSLVGESGSGKTTIGRAIIGLNDTSNGEIIFDGKKINGYLSHS
EKNDLIRRIQMIFQDPAASLNERATVDYILSEGLYNFHLYKDEEERKAKIKEIIKEVGLLEEHLTRYPHEFSGGQRQRIG
IARSLVMQPDLVIADEPISALDVSVRAQVLNLLKKFQKELGLTYLFIAHDLSVVRFISDRIAVIYKGTIVEVAETEELYN
NPIHPYTKSLLSAVPIPDPILERKKVLKVYDPNQHDYSVDKPEMVEVRPGHFVWGNKTEIETYRKEQSK

Nucleotide


Download         Length: 930 bp        

>NTDB_id=260979 CR922_RS02625 WP_002951426.1 490478..491407(+) (amiF) [Streptococcus thermophilus strain EPS]
ATGCCTGAGAAATTAGTTGAAGTAAAAGATGTGGAAATTTCCTTCGGCGAAGGAAGAAAGAAGTTCGTTGCTGTCCACAA
TGCTAATTTTTTCATCAACAAGGGTGAAACCTTCTCCCTCGTTGGTGAGTCTGGTAGTGGTAAAACGACTATTGGACGTG
CCATTATCGGTTTAAATGACACAAGTAATGGTGAGATTATTTTTGACGGTAAGAAGATCAATGGATACTTATCTCACTCT
GAGAAAAACGACCTTATCCGTCGTATTCAGATGATTTTCCAAGACCCTGCGGCTAGTTTGAATGAACGTGCGACAGTCGA
TTATATCTTGTCTGAGGGCTTGTACAATTTCCATCTTTATAAAGATGAGGAAGAACGTAAGGCTAAAATCAAGGAAATCA
TCAAAGAAGTAGGACTTCTTGAGGAGCACTTAACACGTTACCCTCACGAATTTTCTGGGGGACAACGTCAACGTATCGGG
ATTGCGCGTTCTTTGGTCATGCAGCCTGATTTGGTTATCGCTGATGAACCAATCTCAGCCCTTGACGTGTCAGTTCGTGC
CCAAGTTTTGAATTTGCTTAAGAAATTCCAAAAAGAGTTGGGGTTAACCTATCTCTTTATCGCTCACGATTTGTCAGTGG
TCCGTTTCATTTCTGACCGTATCGCTGTTATCTATAAGGGGACAATCGTGGAAGTTGCTGAGACAGAAGAGCTCTACAAC
AATCCTATCCATCCTTACACCAAGTCACTCTTGTCTGCTGTTCCTATTCCAGATCCAATCTTGGAACGTAAGAAAGTCTT
GAAGGTTTATGATCCAAACCAACACGACTATTCGGTTGATAAACCAGAAATGGTGGAAGTACGCCCAGGTCACTTCGTTT
GGGGTAACAAGACAGAAATTGAGACTTATCGTAAAGAACAAAGTAAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A7U7CIU5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  amiF Streptococcus thermophilus LMG 18311

100

100

1

  amiF Streptococcus thermophilus LMD-9

99.676

100

0.997

  amiF Streptococcus salivarius strain HSISS4

98.058

100

0.981


Multiple sequence alignment