Detailed information    

insolico Bioinformatically predicted

Overview


Name   amiF   Type   Regulator
Locus tag   CW339_RS06950 Genome accession   NZ_CP025216
Coordinates   1310198..1311127 (-) Length   309 a.a.
NCBI ID   WP_002951426.1    Uniprot ID   A0A7U7CIU5
Organism   Streptococcus thermophilus strain DGCC 7710     
Function   internalize XIP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1294667..1365701 1310198..1311127 within 0


Gene organization within MGE regions


Location: 1294667..1365701
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CW339_RS06875 (CW339_06875) liaF 1294675..1295373 (-) 699 WP_011226289.1 cell wall-active antibiotics response protein LiaF -
  CW339_RS10505 - 1295628..1295795 (-) 168 WP_014608530.1 potassium channel family protein -
  CW339_RS06885 (CW339_06885) stkP/pknB 1296433..1298304 (-) 1872 WP_024703938.1 Stk1 family PASTA domain-containing Ser/Thr kinase Regulator
  CW339_RS06890 (CW339_06890) - 1298304..1299041 (-) 738 WP_002946881.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  CW339_RS06895 (CW339_06895) rsmB 1299085..1300407 (-) 1323 WP_014608533.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  CW339_RS06900 (CW339_06900) fmt 1300397..1301332 (-) 936 WP_014608534.1 methionyl-tRNA formyltransferase -
  CW339_RS06905 (CW339_06905) - 1301350..1303746 (-) 2397 WP_024703939.1 primosomal protein N' -
  CW339_RS06910 (CW339_06910) rpoZ 1303888..1304202 (-) 315 WP_002951415.1 DNA-directed RNA polymerase subunit omega -
  CW339_RS06915 (CW339_06915) gmk 1304224..1304853 (-) 630 WP_014608537.1 guanylate kinase -
  CW339_RS06920 (CW339_06920) ftsY 1305079..1306470 (-) 1392 WP_014608538.1 signal recognition particle-docking protein FtsY -
  CW339_RS06925 (CW339_06925) - 1306484..1307299 (-) 816 WP_011226298.1 Cof-type HAD-IIB family hydrolase -
  CW339_RS06930 (CW339_06930) - 1307292..1308086 (-) 795 WP_011681412.1 HAD family hydrolase -
  CW339_RS06935 (CW339_06935) - 1308271..1308648 (+) 378 WP_011681413.1 GntR family transcriptional regulator -
  CW339_RS06940 (CW339_06940) - 1308653..1309351 (+) 699 WP_023909821.1 ABC transporter ATP-binding protein -
  CW339_RS06945 (CW339_06945) - 1309363..1310148 (+) 786 WP_002951425.1 hypothetical protein -
  CW339_RS06950 (CW339_06950) amiF 1310198..1311127 (-) 930 WP_002951426.1 ATP-binding cassette domain-containing protein Regulator
  CW339_RS06955 (CW339_06955) amiE 1311120..1312205 (-) 1086 WP_011226304.1 ABC transporter ATP-binding protein Regulator
  CW339_RS06960 (CW339_06960) amiD 1312215..1313141 (-) 927 WP_002946409.1 oligopeptide ABC transporter permease OppC Regulator
  CW339_RS06965 (CW339_06965) amiC 1313141..1314634 (-) 1494 WP_011681416.1 ABC transporter permease Regulator
  CW339_RS06970 (CW339_06970) amiA 1314696..1316663 (-) 1968 WP_024703940.1 peptide ABC transporter substrate-binding protein Regulator
  CW339_RS06975 (CW339_06975) - 1317019..1318197 (+) 1179 Protein_1293 ISL3 family transposase -
  CW339_RS06980 (CW339_06980) amiA3 1318242..1320215 (-) 1974 WP_011681419.1 peptide ABC transporter substrate-binding protein Regulator
  CW339_RS06985 (CW339_06985) - 1320520..1321667 (+) 1148 WP_095559415.1 IS3 family transposase -
  CW339_RS06990 (CW339_06990) - 1321705..1321889 (-) 185 Protein_1296 IS3 family transposase -
  CW339_RS10810 - 1321883..1322639 (-) 757 Protein_1297 TatD family hydrolase -
  CW339_RS07005 (CW339_07005) - 1322985..1324190 (+) 1206 WP_011681420.1 OFA family MFS transporter -
  CW339_RS07010 (CW339_07010) - 1324236..1325549 (-) 1314 Protein_1299 IS3 family transposase -
  CW339_RS07015 (CW339_07015) pta 1325674..1326657 (-) 984 WP_011227420.1 phosphate acetyltransferase -
  CW339_RS07020 (CW339_07020) - 1326671..1327567 (-) 897 WP_024703943.1 RluA family pseudouridine synthase -
  CW339_RS07025 (CW339_07025) - 1327564..1328400 (-) 837 WP_014608552.1 NAD kinase -
  CW339_RS07030 (CW339_07030) - 1328372..1329046 (-) 675 WP_011681427.1 GTP pyrophosphokinase family protein -
  CW339_RS07035 (CW339_07035) - 1329142..1329717 (+) 576 WP_002951444.1 CYTH domain-containing protein -
  CW339_RS07040 (CW339_07040) - 1330080..1331051 (+) 972 WP_002951446.1 ribose-phosphate diphosphokinase -
  CW339_RS07045 (CW339_07045) - 1331055..1332167 (+) 1113 WP_014608554.1 cysteine desulfurase family protein -
  CW339_RS07050 (CW339_07050) - 1332169..1332516 (+) 348 WP_014608555.1 DUF1831 domain-containing protein -
  CW339_RS07055 (CW339_07055) - 1332660..1333319 (+) 660 WP_024703944.1 redox-sensing transcriptional repressor Rex -
  CW339_RS07060 (CW339_07060) - 1333312..1334007 (+) 696 WP_024703945.1 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein -
  CW339_RS07065 (CW339_07065) radC 1334060..1334746 (-) 687 WP_014727630.1 DNA repair protein RadC -
  CW339_RS07070 (CW339_07070) - 1334795..1336579 (-) 1785 WP_024703946.1 rhamnan synthesis F family protein -
  CW339_RS07075 (CW339_07075) - 1336576..1337643 (-) 1068 WP_024703947.1 glycosyltransferase -
  CW339_RS07080 (CW339_07080) - 1337663..1338868 (-) 1206 WP_014727633.1 ABC transporter ATP-binding protein -
  CW339_RS07085 (CW339_07085) - 1338868..1339677 (-) 810 WP_024703948.1 ABC transporter permease -
  CW339_RS07090 (CW339_07090) - 1339661..1340617 (-) 957 WP_024703949.1 glycosyltransferase family 2 protein -
  CW339_RS07095 (CW339_07095) - 1340614..1341762 (-) 1149 WP_024703950.1 glycosyltransferase family 1 protein -
  CW339_RS07100 (CW339_07100) - 1341869..1343410 (-) 1542 WP_024703951.1 DUF2142 domain-containing protein -
  CW339_RS07105 (CW339_07105) - 1343417..1344427 (-) 1011 WP_024703952.1 glycosyltransferase -
  CW339_RS07110 (CW339_07110) - 1344427..1345701 (-) 1275 WP_024703953.1 polysaccharide biosynthesis protein -
  CW339_RS07115 (CW339_07115) - 1345694..1346026 (-) 333 WP_011226332.1 DUF2304 domain-containing protein -
  CW339_RS07120 (CW339_07120) - 1346032..1346727 (-) 696 WP_024703954.1 glycosyltransferase family 2 protein -
  CW339_RS07125 (CW339_07125) rfbD 1346804..1347655 (-) 852 WP_014621820.1 dTDP-4-dehydrorhamnose reductase -
  CW339_RS07130 (CW339_07130) - 1347732..1349066 (-) 1335 WP_024703955.1 DUF6056 family protein -
  CW339_RS07135 (CW339_07135) - 1349179..1350105 (-) 927 WP_024703956.1 glycosyltransferase family 2 protein -
  CW339_RS07140 (CW339_07140) - 1350115..1350450 (-) 336 WP_024703957.1 metal-sulfur cluster assembly factor -
  CW339_RS07145 (CW339_07145) rpoD 1350504..1351613 (-) 1110 WP_011227440.1 RNA polymerase sigma factor RpoD -
  CW339_RS07150 (CW339_07150) dnaG 1351617..1353428 (-) 1812 WP_024703958.1 DNA primase -
  CW339_RS07155 (CW339_07155) mscL 1353568..1353651 (+) 84 Protein_1328 large conductance mechanosensitive channel protein MscL -
  CW339_RS07160 (CW339_07160) rpsU 1353811..1353987 (-) 177 WP_011681449.1 30S ribosomal protein S21 -
  CW339_RS07165 (CW339_07165) - 1354181..1354975 (-) 795 WP_023909836.1 ABC transporter substrate-binding protein -
  CW339_RS07170 (CW339_07170) - 1355037..1356146 (-) 1110 WP_024703959.1 aminotransferase -
  CW339_RS07175 (CW339_07175) - 1356494..1357291 (-) 798 WP_014621828.1 transporter substrate-binding domain-containing protein -
  CW339_RS07180 (CW339_07180) - 1357288..1358118 (-) 831 WP_014621829.1 transporter substrate-binding domain-containing protein -
  CW339_RS07185 (CW339_07185) - 1358332..1358796 (-) 465 WP_011681454.1 8-oxo-dGTP diphosphatase -
  CW339_RS07190 (CW339_07190) uvrB 1358841..1360832 (-) 1992 WP_014608579.1 excinuclease ABC subunit UvrB -
  CW339_RS07195 (CW339_07195) - 1360979..1361446 (-) 468 WP_014608580.1 hypothetical protein -
  CW339_RS07200 (CW339_07200) - 1361519..1362455 (-) 937 Protein_1337 type II CAAX endopeptidase family protein -
  CW339_RS07205 (CW339_07205) - 1362654..1364864 (+) 2211 WP_014727645.1 ABC transporter substrate-binding protein/permease -
  CW339_RS07210 (CW339_07210) - 1364864..1365604 (+) 741 WP_024703961.1 amino acid ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 309 a.a.        Molecular weight: 35171.28 Da        Isoelectric Point: 6.5989

>NTDB_id=258870 CW339_RS06950 WP_002951426.1 1310198..1311127(-) (amiF) [Streptococcus thermophilus strain DGCC 7710]
MPEKLVEVKDVEISFGEGRKKFVAVHNANFFINKGETFSLVGESGSGKTTIGRAIIGLNDTSNGEIIFDGKKINGYLSHS
EKNDLIRRIQMIFQDPAASLNERATVDYILSEGLYNFHLYKDEEERKAKIKEIIKEVGLLEEHLTRYPHEFSGGQRQRIG
IARSLVMQPDLVIADEPISALDVSVRAQVLNLLKKFQKELGLTYLFIAHDLSVVRFISDRIAVIYKGTIVEVAETEELYN
NPIHPYTKSLLSAVPIPDPILERKKVLKVYDPNQHDYSVDKPEMVEVRPGHFVWGNKTEIETYRKEQSK

Nucleotide


Download         Length: 930 bp        

>NTDB_id=258870 CW339_RS06950 WP_002951426.1 1310198..1311127(-) (amiF) [Streptococcus thermophilus strain DGCC 7710]
ATGCCTGAGAAATTAGTTGAAGTAAAAGATGTGGAAATTTCCTTCGGCGAAGGAAGAAAGAAGTTCGTTGCTGTCCACAA
TGCTAATTTTTTCATCAACAAGGGTGAAACCTTCTCCCTCGTTGGTGAGTCTGGTAGTGGTAAAACGACTATTGGACGTG
CCATTATCGGTTTAAATGACACAAGTAATGGTGAGATTATTTTTGACGGTAAGAAGATCAATGGATACTTATCTCACTCT
GAGAAAAACGACCTTATCCGTCGTATTCAGATGATTTTCCAAGACCCTGCGGCTAGTTTGAATGAACGTGCGACAGTCGA
TTATATCTTGTCTGAGGGCTTGTACAATTTCCATCTTTATAAAGATGAGGAAGAACGTAAGGCTAAAATCAAGGAAATCA
TCAAAGAAGTAGGACTTCTTGAGGAGCACTTAACACGTTACCCTCACGAATTTTCTGGGGGACAACGTCAACGTATCGGG
ATTGCGCGTTCTTTGGTCATGCAGCCTGATTTGGTTATCGCTGATGAACCAATCTCAGCCCTTGACGTGTCAGTTCGTGC
CCAAGTTTTGAATTTGCTTAAGAAATTCCAAAAAGAGTTGGGGTTAACCTATCTCTTTATCGCTCACGATTTGTCAGTGG
TCCGTTTCATTTCTGATCGTATCGCTGTTATCTATAAGGGGACAATCGTGGAAGTTGCTGAGACAGAAGAGCTCTACAAC
AATCCTATCCATCCTTACACCAAGTCACTCTTGTCTGCTGTTCCTATTCCAGATCCAATCTTGGAACGTAAGAAAGTCTT
GAAGGTTTATGATCCAAACCAACACGACTATTCGGTTGATAAACCAGAAATGGTGGAAGTACGCCCAGGTCACTTCGTTT
GGGGTAACAAGACAGAAATTGAGACTTATCGTAAAGAACAAAGTAAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A7U7CIU5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  amiF Streptococcus thermophilus LMG 18311

100

100

1

  amiF Streptococcus thermophilus LMD-9

99.676

100

0.997

  amiF Streptococcus salivarius strain HSISS4

98.058

100

0.981


Multiple sequence alignment