Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   CP943_RS13675 Genome accession   NZ_CP023665
Coordinates   2703845..2704021 (+) Length   58 a.a.
NCBI ID   WP_023855184.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain Bac84     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2698845..2709021
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CP943_RS13655 gcvT 2699485..2700579 (-) 1095 WP_095291099.1 glycine cleavage system aminomethyltransferase GcvT -
  CP943_RS13665 - 2701174..2702853 (+) 1680 WP_020452163.1 DEAD/DEAH box helicase -
  CP943_RS13670 - 2702860..2703654 (+) 795 WP_020452164.1 YqhG family protein -
  CP943_RS13675 sinI 2703845..2704021 (+) 177 WP_023855184.1 anti-repressor SinI Regulator
  CP943_RS13680 sinR 2704055..2704390 (+) 336 WP_023855185.1 transcriptional regulator SinR Regulator
  CP943_RS13685 tasA 2704495..2705289 (-) 795 WP_020452167.1 biofilm matrix protein TasA -
  CP943_RS13690 sipW 2705362..2705946 (-) 585 WP_020452168.1 signal peptidase I SipW -
  CP943_RS13695 tapA 2705943..2706671 (-) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  CP943_RS13700 - 2706949..2707269 (+) 321 WP_023855188.1 YqzG/YhdC family protein -
  CP943_RS13705 - 2707299..2707481 (-) 183 WP_020452171.1 YqzE family protein -
  CP943_RS13710 comGG 2707570..2707935 (-) 366 WP_025811163.1 competence type IV pilus minor pilin ComGG -
  CP943_RS13715 comGF 2707947..2708435 (-) 489 WP_224067282.1 competence type IV pilus minor pilin ComGF -
  CP943_RS13720 comGE 2708344..2708691 (-) 348 WP_023855191.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6709.46 Da        Isoelectric Point: 4.5938

>NTDB_id=249040 CP943_RS13675 WP_023855184.1 2703845..2704021(+) (sinI) [Bacillus paralicheniformis strain Bac84]
MNKDKNEKEELDEEWTELIKHALEQGISPEDIRIFLNLGEKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=249040 CP943_RS13675 WP_023855184.1 2703845..2704021(+) (sinI) [Bacillus paralicheniformis strain Bac84]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGATATACGTATTTTTCTCAATTTGGGTGAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5

Multiple sequence alignment