Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   CJ306_RS20080 Genome accession   NZ_CP023245
Coordinates   3891580..3892359 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus cereus strain HBL-AI     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3866270..3928046 3891580..3892359 within 0


Gene organization within MGE regions


Location: 3866270..3928046
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CJ306_RS19970 (CJ306_20505) - 3866840..3867739 (-) 900 WP_119683861.1 polysaccharide deacetylase family protein -
  CJ306_RS19975 (CJ306_20510) pnp 3867891..3870029 (-) 2139 WP_000076737.1 polyribonucleotide nucleotidyltransferase -
  CJ306_RS19980 (CJ306_20515) rpsO 3870190..3870459 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  CJ306_RS19985 (CJ306_20520) ribF 3870560..3871531 (-) 972 WP_119683862.1 bifunctional riboflavin kinase/FAD synthetase -
  CJ306_RS19990 (CJ306_20525) truB 3871575..3872498 (-) 924 WP_000399351.1 tRNA pseudouridine(55) synthase TruB -
  CJ306_RS19995 (CJ306_20530) rbfA 3872585..3872941 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  CJ306_RS20000 (CJ306_20535) - 3872957..3873238 (-) 282 WP_000582363.1 DUF503 family protein -
  CJ306_RS20005 (CJ306_20540) infB 3873235..3875295 (-) 2061 WP_000036343.1 translation initiation factor IF-2 -
  CJ306_RS20010 (CJ306_20545) - 3875300..3875611 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  CJ306_RS20015 (CJ306_20550) - 3875612..3875884 (-) 273 WP_000071127.1 YlxR family protein -
  CJ306_RS20020 (CJ306_20555) nusA 3875896..3877002 (-) 1107 WP_000102604.1 transcription termination factor NusA -
  CJ306_RS20025 (CJ306_20560) rimP 3877020..3877490 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  CJ306_RS20030 (CJ306_20565) - 3877827..3882128 (-) 4302 WP_000060005.1 PolC-type DNA polymerase III -
  CJ306_RS20035 (CJ306_20570) - 3882253..3883953 (-) 1701 WP_000814302.1 proline--tRNA ligase -
  CJ306_RS20040 (CJ306_20575) rseP 3884063..3885319 (-) 1257 WP_001090240.1 RIP metalloprotease RseP -
  CJ306_RS20045 (CJ306_20580) dxr 3885337..3886479 (-) 1143 WP_000790373.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  CJ306_RS20050 (CJ306_20585) cdsA 3886503..3887294 (-) 792 WP_000813593.1 phosphatidate cytidylyltransferase -
  CJ306_RS20055 (CJ306_20590) uppS 3887312..3888088 (-) 777 WP_000971296.1 isoprenyl transferase -
  CJ306_RS20060 (CJ306_20595) frr 3888174..3888731 (-) 558 WP_000531501.1 ribosome recycling factor -
  CJ306_RS20065 (CJ306_20600) pyrH 3888734..3889456 (-) 723 WP_000042668.1 UMP kinase -
  CJ306_RS20070 (CJ306_20605) tsf 3889523..3890410 (-) 888 WP_001018578.1 translation elongation factor Ts -
  CJ306_RS20075 (CJ306_20610) rpsB 3890514..3891215 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  CJ306_RS20080 (CJ306_20615) codY 3891580..3892359 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  CJ306_RS20085 (CJ306_20620) hslU 3892437..3893828 (-) 1392 WP_000550078.1 ATP-dependent protease ATPase subunit HslU -
  CJ306_RS20090 (CJ306_20625) hslV 3893851..3894393 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  CJ306_RS20095 (CJ306_20630) xerC 3894436..3895335 (-) 900 WP_001101243.1 tyrosine recombinase XerC -
  CJ306_RS20100 (CJ306_20635) trmFO 3895401..3896705 (-) 1305 WP_000213002.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  CJ306_RS20105 (CJ306_20640) topA 3896754..3898832 (-) 2079 WP_001286963.1 type I DNA topoisomerase -
  CJ306_RS20110 (CJ306_20645) dprA 3898977..3899846 (-) 870 WP_119683863.1 DNA-processing protein DprA -
  CJ306_RS20115 (CJ306_20650) sucD 3899935..3900837 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  CJ306_RS20120 (CJ306_20655) sucC 3900857..3902017 (-) 1161 WP_119683864.1 ADP-forming succinate--CoA ligase subunit beta -
  CJ306_RS20125 (CJ306_20660) - 3902212..3902985 (-) 774 WP_001194265.1 ribonuclease HII -
  CJ306_RS20130 (CJ306_20665) ylqF 3903042..3903932 (-) 891 WP_119683865.1 ribosome biogenesis GTPase YlqF -
  CJ306_RS20135 (CJ306_20670) lepB 3903953..3904504 (-) 552 WP_000711853.1 signal peptidase I -
  CJ306_RS20140 (CJ306_20675) rplS 3904606..3904950 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  CJ306_RS20145 (CJ306_20680) trmD 3905097..3905831 (-) 735 WP_000686903.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  CJ306_RS20150 (CJ306_20685) rimM 3905831..3906346 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  CJ306_RS20155 (CJ306_20690) - 3906468..3906695 (-) 228 WP_000737401.1 KH domain-containing protein -
  CJ306_RS20160 (CJ306_20695) rpsP 3906710..3906982 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  CJ306_RS20165 (CJ306_20700) ffh 3907084..3908433 (-) 1350 WP_000863460.1 signal recognition particle protein -
  CJ306_RS20170 (CJ306_20705) - 3908446..3908778 (-) 333 WP_000891062.1 putative DNA-binding protein -
  CJ306_RS20175 (CJ306_20710) ftsY 3908912..3909901 (-) 990 WP_000007655.1 signal recognition particle-docking protein FtsY -
  CJ306_RS20180 (CJ306_20715) smc 3909917..3913486 (-) 3570 WP_000478973.1 chromosome segregation protein SMC -
  CJ306_RS20185 (CJ306_20720) rncS 3913633..3914370 (-) 738 WP_001146875.1 ribonuclease III -
  CJ306_RS20190 (CJ306_20725) acpP 3914429..3914662 (-) 234 WP_000786062.1 acyl carrier protein -
  CJ306_RS20195 (CJ306_20730) fabG 3914732..3915472 (-) 741 WP_000911773.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  CJ306_RS20200 (CJ306_20735) fabD 3915472..3916416 (-) 945 WP_119683866.1 ACP S-malonyltransferase -
  CJ306_RS20205 (CJ306_20740) plsX 3916431..3917423 (-) 993 WP_000684102.1 phosphate acyltransferase PlsX -
  CJ306_RS20210 (CJ306_20745) fapR 3917420..3918013 (-) 594 WP_000747348.1 transcription factor FapR -
  CJ306_RS20215 (CJ306_20750) recG 3918102..3920150 (-) 2049 WP_001000816.1 ATP-dependent DNA helicase RecG -
  CJ306_RS20220 (CJ306_20755) - 3920441..3922117 (-) 1677 WP_000027129.1 DAK2 domain-containing protein -
  CJ306_RS20225 (CJ306_20760) - 3922140..3922502 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  CJ306_RS20230 (CJ306_20765) rpmB 3922879..3923067 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  CJ306_RS20235 (CJ306_20770) spoVM 3923141..3923221 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  CJ306_RS20240 (CJ306_20775) - 3923288..3923968 (-) 681 WP_002183880.1 thiamine diphosphokinase -
  CJ306_RS20245 (CJ306_20780) rpe 3924038..3924682 (-) 645 WP_000589974.1 ribulose-phosphate 3-epimerase -
  CJ306_RS20250 (CJ306_20785) rsgA 3924685..3925566 (-) 882 WP_001113932.1 ribosome small subunit-dependent GTPase A -
  CJ306_RS20255 (CJ306_20790) pknB 3925813..3927786 (-) 1974 WP_000904747.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=245373 CJ306_RS20080 WP_000421290.1 3891580..3892359(-) (codY) [Bacillus cereus strain HBL-AI]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=245373 CJ306_RS20080 WP_000421290.1 3891580..3892359(-) (codY) [Bacillus cereus strain HBL-AI]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCGCGTAGTAAAGCTGTTGTTCAAATGGCAATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GCTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAAGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459


Multiple sequence alignment