Detailed information
Bioinformatically predicted
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | CK945_RS14560 | Genome accession | NZ_CP023168 |
| Coordinates | 2821219..2821482 (-) | Length | 87 a.a. |
| NCBI ID | WP_096748222.1 | Uniprot ID | - |
| Organism | Bacillus paralicheniformis strain 14DA11 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2821608..2875206 | 2821219..2821482 | flank | 126 |
Gene organization within MGE regions
Location: 2821219..2875206
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CK945_RS14560 | comGC | 2821219..2821482 (-) | 264 | WP_096748222.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| CK945_RS14565 | - | 2821608..2822297 (+) | 690 | WP_080624021.1 | hypothetical protein | - |
| CK945_RS14570 | - | 2822464..2823204 (+) | 741 | WP_080624022.1 | helix-turn-helix domain-containing protein | - |
| CK945_RS14575 | - | 2823304..2824368 (-) | 1065 | WP_080624023.1 | hypothetical protein | - |
| CK945_RS14580 | - | 2824394..2824720 (-) | 327 | WP_080624024.1 | hypothetical protein | - |
| CK945_RS14585 | - | 2824994..2825851 (+) | 858 | WP_080624025.1 | SMI1/KNR4 family protein | - |
| CK945_RS14590 | - | 2825931..2826791 (+) | 861 | WP_016886590.1 | HNH endonuclease | - |
| CK945_RS23985 | - | 2826831..2827078 (-) | 248 | Protein_2839 | peptidoglycan-binding domain-containing protein | - |
| CK945_RS23990 | - | 2827190..2827903 (-) | 714 | Protein_2840 | N-acetylmuramoyl-L-alanine amidase | - |
| CK945_RS14600 | - | 2827955..2828218 (-) | 264 | WP_080624027.1 | phage holin | - |
| CK945_RS14605 | - | 2828234..2828503 (-) | 270 | WP_020450984.1 | hemolysin XhlA family protein | - |
| CK945_RS14610 | - | 2828583..2829416 (-) | 834 | WP_080624028.1 | hypothetical protein | - |
| CK945_RS14615 | - | 2829518..2829700 (-) | 183 | WP_043929126.1 | XkdX family protein | - |
| CK945_RS14620 | - | 2829697..2830026 (-) | 330 | WP_044822060.1 | XkdW family protein | - |
| CK945_RS14625 | - | 2830038..2831141 (-) | 1104 | WP_080624029.1 | hypothetical protein | - |
| CK945_RS14630 | - | 2831142..2831417 (-) | 276 | WP_080624030.1 | hypothetical protein | - |
| CK945_RS14635 | - | 2831414..2831992 (-) | 579 | WP_080624031.1 | YmfQ family protein | - |
| CK945_RS14640 | - | 2831979..2833022 (-) | 1044 | WP_080624032.1 | baseplate J/gp47 family protein | - |
| CK945_RS14645 | - | 2833015..2833440 (-) | 426 | WP_076793407.1 | DUF2634 domain-containing protein | - |
| CK945_RS14650 | - | 2833453..2833761 (-) | 309 | WP_016886601.1 | DUF2577 domain-containing protein | - |
| CK945_RS14655 | - | 2833758..2834741 (-) | 984 | WP_080624033.1 | phage portal protein | - |
| CK945_RS14660 | - | 2834763..2835422 (-) | 660 | WP_080624034.1 | LysM peptidoglycan-binding domain-containing protein | - |
| CK945_RS14665 | - | 2835415..2840679 (-) | 5265 | WP_080624035.1 | transglycosylase SLT domain-containing protein | - |
| CK945_RS14670 | - | 2840683..2840832 (-) | 150 | WP_096748223.1 | hypothetical protein | - |
| CK945_RS14675 | - | 2840862..2841311 (-) | 450 | WP_080624036.1 | phage tail assembly chaperone | - |
| CK945_RS24445 | - | 2841460..2841654 (+) | 195 | WP_080624037.1 | putative holin-like toxin | - |
| CK945_RS23995 | - | 2842032..2842109 (+) | 78 | WP_223831559.1 | putative holin-like toxin | - |
| CK945_RS14690 | - | 2842382..2842825 (-) | 444 | WP_080624039.1 | phage tail tube protein | - |
| CK945_RS14695 | - | 2842827..2844227 (-) | 1401 | WP_080624040.1 | phage tail sheath family protein | - |
| CK945_RS14700 | - | 2844228..2844455 (-) | 228 | WP_080624041.1 | hypothetical protein | - |
| CK945_RS14705 | - | 2844456..2844896 (-) | 441 | WP_231124464.1 | phage tail terminator family protein | - |
| CK945_RS14710 | - | 2844910..2845407 (-) | 498 | WP_080624043.1 | HK97 gp10 family phage protein | - |
| CK945_RS14715 | - | 2845404..2845760 (-) | 357 | WP_080624044.1 | YqbH/XkdH family protein | - |
| CK945_RS14720 | - | 2845757..2846152 (-) | 396 | WP_080624045.1 | DUF3199 family protein | - |
| CK945_RS14725 | - | 2846159..2846572 (-) | 414 | WP_080624046.1 | YqbF domain-containing protein | - |
| CK945_RS14730 | - | 2846583..2847518 (-) | 936 | WP_080624047.1 | phage major capsid protein | - |
| CK945_RS14735 | - | 2847531..2848706 (-) | 1176 | WP_080624048.1 | XkdF-like putative serine protease domain-containing protein | - |
| CK945_RS14740 | - | 2848712..2849584 (-) | 873 | WP_080624049.1 | hypothetical protein | - |
| CK945_RS14745 | - | 2849633..2850550 (-) | 918 | WP_080624050.1 | phage minor head protein | - |
| CK945_RS14750 | - | 2850543..2852080 (-) | 1538 | Protein_2871 | phage portal protein | - |
| CK945_RS14755 | - | 2852084..2853379 (-) | 1296 | WP_080624052.1 | PBSX family phage terminase large subunit | - |
| CK945_RS14760 | terS | 2853376..2854244 (-) | 869 | Protein_2873 | phage terminase small subunit | - |
| CK945_RS14765 | - | 2854431..2854721 (-) | 291 | WP_080624054.1 | hypothetical protein | - |
| CK945_RS14770 | - | 2855012..2855215 (-) | 204 | WP_080624055.1 | hypothetical protein | - |
| CK945_RS23450 | - | 2855269..2855442 (-) | 174 | WP_157765913.1 | hypothetical protein | - |
| CK945_RS14780 | - | 2855719..2856183 (-) | 465 | WP_196775411.1 | SMI1/KNR4 family protein | - |
| CK945_RS14785 | - | 2856204..2858081 (-) | 1878 | WP_080624056.1 | T7SS effector LXG polymorphic toxin | - |
| CK945_RS14790 | - | 2858363..2859466 (+) | 1104 | WP_096748224.1 | Rap family tetratricopeptide repeat protein | - |
| CK945_RS24225 | - | 2859466..2859600 (+) | 135 | WP_257475243.1 | hypothetical protein | - |
| CK945_RS14795 | - | 2859647..2860030 (-) | 384 | WP_080624058.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| CK945_RS14800 | - | 2860121..2860774 (-) | 654 | WP_080624059.1 | hypothetical protein | - |
| CK945_RS14805 | - | 2860771..2860971 (-) | 201 | WP_080624060.1 | XtrA/YqaO family protein | - |
| CK945_RS24000 | - | 2860990..2861130 (-) | 141 | WP_231124459.1 | hypothetical protein | - |
| CK945_RS14815 | - | 2861298..2861855 (+) | 558 | WP_080624062.1 | GNAT family N-acetyltransferase | - |
| CK945_RS14820 | - | 2861848..2862054 (-) | 207 | WP_080624231.1 | XtrA/YqaO family protein | - |
| CK945_RS14825 | - | 2862128..2862394 (-) | 267 | WP_080624063.1 | ASCH/PUA domain-containing protein | - |
| CK945_RS14830 | - | 2862637..2863314 (-) | 678 | WP_167511159.1 | hypothetical protein | - |
| CK945_RS14835 | - | 2863284..2863742 (-) | 459 | WP_080624064.1 | RusA family crossover junction endodeoxyribonuclease | - |
| CK945_RS14840 | - | 2863879..2864139 (-) | 261 | WP_080624065.1 | IDEAL domain-containing protein | - |
| CK945_RS14845 | - | 2864247..2864441 (-) | 195 | WP_231124460.1 | Fur-regulated basic protein FbpA | - |
| CK945_RS14850 | dnaB | 2864459..2865763 (-) | 1305 | WP_080624066.1 | replicative DNA helicase | - |
| CK945_RS14855 | - | 2865738..2866019 (-) | 282 | WP_080624067.1 | replicative helicase loader/inhibitor | - |
| CK945_RS14860 | - | 2865937..2866833 (-) | 897 | WP_198403083.1 | hypothetical protein | - |
| CK945_RS14865 | recT | 2867001..2867951 (-) | 951 | WP_080624069.1 | recombination protein RecT | - |
| CK945_RS14870 | - | 2867944..2868894 (-) | 951 | WP_080624070.1 | YqaJ viral recombinase family protein | - |
| CK945_RS14875 | - | 2868894..2869073 (-) | 180 | WP_017474946.1 | hypothetical protein | - |
| CK945_RS14880 | - | 2869194..2869406 (-) | 213 | WP_080624071.1 | YqaI family protein | - |
| CK945_RS14885 | - | 2869419..2869613 (-) | 195 | WP_080624072.1 | hypothetical protein | - |
| CK945_RS14890 | - | 2869741..2869929 (-) | 189 | WP_080624073.1 | hypothetical protein | - |
| CK945_RS14895 | - | 2870192..2870719 (-) | 528 | WP_080624075.1 | helix-turn-helix domain-containing protein | - |
| CK945_RS14900 | - | 2871017..2871220 (-) | 204 | WP_080624077.1 | helix-turn-helix domain-containing protein | - |
| CK945_RS14905 | - | 2871344..2871766 (+) | 423 | WP_231124461.1 | helix-turn-helix domain-containing protein | - |
| CK945_RS14910 | - | 2871962..2872462 (+) | 501 | WP_080624078.1 | ImmA/IrrE family metallo-endopeptidase | - |
| CK945_RS14915 | - | 2872455..2873627 (+) | 1173 | WP_080624079.1 | hypothetical protein | - |
| CK945_RS14920 | - | 2873674..2875206 (+) | 1533 | WP_167511160.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 87 a.a. Molecular weight: 9494.10 Da Isoelectric Point: 8.5106
>NTDB_id=245116 CK945_RS14560 WP_096748222.1 2821219..2821482(-) (comGC) [Bacillus paralicheniformis strain 14DA11]
MLVVMLVISILLLITIPNVTKHNQSIQKKGCEGLINMVEAQITAYQMDHDGKTPSRADLESEGYVKKNLKCPNGKAIKIS
NGNAQAD
MLVVMLVISILLLITIPNVTKHNQSIQKKGCEGLINMVEAQITAYQMDHDGKTPSRADLESEGYVKKNLKCPNGKAIKIS
NGNAQAD
Nucleotide
Download Length: 264 bp
>NTDB_id=245116 CK945_RS14560 WP_096748222.1 2821219..2821482(-) (comGC) [Bacillus paralicheniformis strain 14DA11]
ATGTTAGTCGTCATGCTCGTCATCTCCATCCTGCTGTTGATCACCATACCGAATGTGACCAAGCATAATCAAAGTATTCA
AAAGAAAGGATGCGAAGGGTTAATTAATATGGTTGAAGCGCAAATCACGGCTTATCAAATGGATCATGACGGGAAAACGC
CGAGTAGGGCGGACCTTGAATCTGAAGGTTACGTGAAGAAGAACTTAAAGTGCCCGAATGGGAAAGCAATTAAAATTTCA
AACGGCAATGCACAGGCTGATTGA
ATGTTAGTCGTCATGCTCGTCATCTCCATCCTGCTGTTGATCACCATACCGAATGTGACCAAGCATAATCAAAGTATTCA
AAAGAAAGGATGCGAAGGGTTAATTAATATGGTTGAAGCGCAAATCACGGCTTATCAAATGGATCATGACGGGAAAACGC
CGAGTAGGGCGGACCTTGAATCTGAAGGTTACGTGAAGAAGAACTTAAAGTGCCCGAATGGGAAAGCAATTAAAATTTCA
AACGGCAATGCACAGGCTGATTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
67.606 |
81.609 |
0.552 |