Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   CJF63_RS07780 Genome accession   NZ_CP023001
Coordinates   1408576..1409355 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus anthracis strain 14RA5914     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1374254..1448177 1408576..1409355 within 0


Gene organization within MGE regions


Location: 1374254..1448177
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CJF63_RS07615 - 1374598..1376268 (-) 1671 WP_000823085.1 ribonuclease J -
  CJF63_RS07625 dapA 1377034..1377912 (-) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  CJF63_RS07630 dapG 1377924..1379156 (-) 1233 WP_000692470.1 aspartate kinase -
  CJF63_RS07635 asd 1379180..1380226 (-) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  CJF63_RS07640 dpaB 1380377..1380976 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  CJF63_RS07645 dpaA 1380973..1381875 (-) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  CJF63_RS07655 - 1382150..1382401 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  CJF63_RS07660 - 1382528..1383769 (-) 1242 WP_000592993.1 M16 family metallopeptidase -
  CJF63_RS07665 - 1383856..1384755 (-) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  CJF63_RS07670 pnp 1384907..1387045 (-) 2139 WP_000076733.1 polyribonucleotide nucleotidyltransferase -
  CJF63_RS07675 rpsO 1387206..1387475 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  CJF63_RS07680 ribF 1387576..1388547 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  CJF63_RS07685 truB 1388591..1389514 (-) 924 WP_000399357.1 tRNA pseudouridine(55) synthase TruB -
  CJF63_RS07690 rbfA 1389601..1389957 (-) 357 WP_000776446.1 30S ribosome-binding factor RbfA -
  CJF63_RS07695 - 1389973..1390254 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  CJF63_RS07700 infB 1390251..1392311 (-) 2061 WP_000036339.1 translation initiation factor IF-2 -
  CJF63_RS07705 - 1392316..1392627 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  CJF63_RS07710 rnpM 1392628..1392900 (-) 273 WP_000071128.1 RNase P modulator RnpM -
  CJF63_RS07715 nusA 1392912..1394018 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  CJF63_RS07720 rimP 1394036..1394506 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  CJF63_RS07725 - 1394839..1399140 (-) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  CJF63_RS07735 - 1399265..1400965 (-) 1701 WP_000814312.1 proline--tRNA ligase -
  CJF63_RS07740 rseP 1401075..1402331 (-) 1257 WP_001090228.1 RIP metalloprotease RseP -
  CJF63_RS07745 dxr 1402348..1403490 (-) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  CJF63_RS07750 cdsA 1403514..1404305 (-) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  CJF63_RS07755 uppS 1404323..1405099 (-) 777 WP_000971303.1 isoprenyl transferase -
  CJF63_RS07760 frr 1405185..1405742 (-) 558 WP_000531498.1 ribosome recycling factor -
  CJF63_RS07765 pyrH 1405745..1406467 (-) 723 WP_000042663.1 UMP kinase -
  CJF63_RS07770 tsf 1406534..1407421 (-) 888 WP_001018581.1 translation elongation factor Ts -
  CJF63_RS07775 rpsB 1407525..1408226 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  CJF63_RS07780 codY 1408576..1409355 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  CJF63_RS07785 hslU 1409433..1410824 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  CJF63_RS07790 hslV 1410847..1411389 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  CJF63_RS07795 xerC 1411432..1412331 (-) 900 WP_001101226.1 tyrosine recombinase XerC -
  CJF63_RS07800 trmFO 1412397..1413701 (-) 1305 WP_003161605.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  CJF63_RS07805 topA 1413752..1415830 (-) 2079 WP_001286969.1 type I DNA topoisomerase -
  CJF63_RS07810 dprA 1415975..1416723 (-) 749 Protein_1460 DNA-processing protein DprA -
  CJF63_RS07815 sucD 1416931..1417833 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  CJF63_RS07820 sucC 1417854..1419014 (-) 1161 WP_001020786.1 ADP-forming succinate--CoA ligase subunit beta -
  CJF63_RS07825 rnhB 1419208..1419981 (-) 774 WP_001174712.1 ribonuclease HII -
  CJF63_RS07830 ylqF 1420033..1420923 (-) 891 WP_000236707.1 ribosome biogenesis GTPase YlqF -
  CJF63_RS07835 lepB 1420944..1421495 (-) 552 WP_000711857.1 signal peptidase I -
  CJF63_RS07840 rplS 1421597..1421941 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  CJF63_RS07845 trmD 1422088..1422822 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  CJF63_RS07850 rimM 1422822..1423337 (-) 516 WP_000170269.1 ribosome maturation factor RimM -
  CJF63_RS07855 - 1423458..1423685 (-) 228 WP_000737398.1 KH domain-containing protein -
  CJF63_RS07860 rpsP 1423700..1423972 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  CJF63_RS07865 ffh 1424073..1425422 (-) 1350 WP_000863456.1 signal recognition particle protein -
  CJF63_RS07870 - 1425435..1425767 (-) 333 WP_000891062.1 putative DNA-binding protein -
  CJF63_RS07875 ftsY 1425900..1426889 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  CJF63_RS07880 smc 1426905..1430474 (-) 3570 WP_000478985.1 chromosome segregation protein SMC -
  CJF63_RS07885 rncS 1430621..1431358 (-) 738 WP_001146873.1 ribonuclease III -
  CJF63_RS07890 acpP 1431417..1431650 (-) 234 WP_000786062.1 acyl carrier protein -
  CJF63_RS07895 fabG 1431720..1432460 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  CJF63_RS07900 fabD 1432460..1433404 (-) 945 WP_000516958.1 ACP S-malonyltransferase -
  CJF63_RS07905 plsX 1433419..1434411 (-) 993 WP_000684111.1 phosphate acyltransferase PlsX -
  CJF63_RS07910 fapR 1434408..1435001 (-) 594 WP_000747352.1 transcription factor FapR -
  CJF63_RS07915 recG 1435090..1437138 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  CJF63_RS07920 - 1437428..1439104 (-) 1677 WP_000027136.1 DAK2 domain-containing protein -
  CJF63_RS07925 - 1439127..1439489 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  CJF63_RS07930 rpmB 1439868..1440056 (+) 189 WP_000124778.1 50S ribosomal protein L28 -
  CJF63_RS07935 spoVM 1440129..1440209 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  CJF63_RS07940 - 1440276..1440956 (-) 681 WP_025388434.1 thiamine diphosphokinase -
  CJF63_RS07945 rpe 1441056..1441700 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  CJF63_RS07950 rsgA 1441703..1442584 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  CJF63_RS07955 prkC 1442853..1444826 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  CJF63_RS07960 - 1444835..1445587 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  CJF63_RS07965 rlmN 1445592..1446680 (-) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  CJF63_RS07970 rsmB 1446685..1448019 (-) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=243945 CJF63_RS07780 WP_000421288.1 1408576..1409355(-) (codY) [Bacillus anthracis strain 14RA5914]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=243945 CJF63_RS07780 WP_000421288.1 1408576..1409355(-) (codY) [Bacillus anthracis strain 14RA5914]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459

Multiple sequence alignment