Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   C7M28_RS03260 Genome accession   NZ_CP028215
Coordinates   609475..609858 (-) Length   127 a.a.
NCBI ID   WP_046160582.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM102750     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 604475..614858
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M28_RS03220 (C7M28_00639) sinI 605408..605581 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  C7M28_RS03225 (C7M28_00640) sinR 605615..605950 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C7M28_RS03230 (C7M28_00641) tasA 606043..606828 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  C7M28_RS03235 (C7M28_00642) sipW 606892..607464 (-) 573 WP_003230181.1 signal peptidase I SipW -
  C7M28_RS03240 (C7M28_00643) tapA 607448..608209 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  C7M28_RS03245 (C7M28_00644) yqzG 608481..608807 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  C7M28_RS03250 (C7M28_00645) spoIITA 608849..609028 (-) 180 WP_029726723.1 YqzE family protein -
  C7M28_RS03255 (C7M28_00646) comGG 609100..609474 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  C7M28_RS03260 comGF 609475..609858 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  C7M28_RS03265 (C7M28_00648) comGE 609884..610231 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene
  C7M28_RS03270 (C7M28_00649) comGD 610215..610646 (-) 432 WP_046381179.1 comG operon protein ComGD Machinery gene
  C7M28_RS03275 (C7M28_00650) comGC 610636..610932 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  C7M28_RS03280 (C7M28_00651) comGB 610946..611983 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  C7M28_RS03285 (C7M28_00652) comGA 611970..613040 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  C7M28_RS03290 (C7M28_00653) - 613252..613449 (-) 198 WP_014480259.1 CBS domain-containing protein -
  C7M28_RS03295 (C7M28_00654) corA 613451..614404 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14306.38 Da        Isoelectric Point: 5.5289

>NTDB_id=240152 C7M28_RS03260 WP_046160582.1 609475..609858(-) (comGF) [Bacillus subtilis strain SRCM102750]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYQSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=240152 C7M28_RS03260 WP_046160582.1 609475..609858(-) (comGF) [Bacillus subtilis strain SRCM102750]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCAATCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984