Detailed information
Bioinformatically predicted
Overview
| Name | comFC | Type | Machinery gene |
| Locus tag | CGZ47_RS08085 | Genome accession | NZ_CP022475 |
| Coordinates | 1556667..1557197 (-) | Length | 176 a.a. |
| NCBI ID | WP_148484979.1 | Uniprot ID | - |
| Organism | Latilactobacillus curvatus strain KG6 | ||
| Function | ssDNA transport into the cell (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1490901..1576133 | 1556667..1557197 | within | 0 |
Gene organization within MGE regions
Location: 1490901..1576133
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CGZ47_RS07785 (CGZ47_07785) | - | 1491263..1491484 (-) | 222 | WP_231118790.1 | DUF6506 family protein | - |
| CGZ47_RS07790 (CGZ47_07790) | - | 1491656..1492261 (-) | 606 | WP_076787867.1 | response regulator transcription factor | - |
| CGZ47_RS07795 (CGZ47_07795) | - | 1492258..1493382 (-) | 1125 | WP_076787865.1 | sensor histidine kinase | - |
| CGZ47_RS10655 | - | 1493379..1493567 (-) | 189 | WP_076787863.1 | hypothetical protein | - |
| CGZ47_RS07800 (CGZ47_07800) | - | 1493595..1494125 (-) | 531 | WP_232505298.1 | ABC transporter permease | - |
| CGZ47_RS07805 (CGZ47_07805) | - | 1494129..1495001 (-) | 873 | WP_081395390.1 | ATP-binding cassette domain-containing protein | - |
| CGZ47_RS07810 (CGZ47_07810) | - | 1495144..1495785 (+) | 642 | WP_089542290.1 | DNA-3-methyladenine glycosylase | - |
| CGZ47_RS07815 (CGZ47_07815) | - | 1495872..1496990 (+) | 1119 | WP_089542291.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| CGZ47_RS07820 (CGZ47_07820) | - | 1497084..1497758 (+) | 675 | WP_089541843.1 | helix-turn-helix domain-containing protein | - |
| CGZ47_RS07825 (CGZ47_07825) | - | 1497755..1498648 (+) | 894 | WP_035187177.1 | IS3 family transposase | - |
| CGZ47_RS10485 | - | 1498718..1498885 (-) | 168 | WP_004265902.1 | hypothetical protein | - |
| CGZ47_RS07830 (CGZ47_07830) | - | 1498959..1499813 (+) | 855 | WP_052202678.1 | helix-turn-helix transcriptional regulator | - |
| CGZ47_RS10660 | - | 1499810..1500160 (-) | 351 | WP_232505299.1 | zinc-binding alcohol dehydrogenase | - |
| CGZ47_RS10665 | - | 1500179..1500727 (-) | 549 | WP_232505300.1 | alcohol dehydrogenase catalytic domain-containing protein | - |
| CGZ47_RS07840 (CGZ47_07840) | - | 1500955..1501335 (-) | 381 | WP_089542292.1 | hypothetical protein | - |
| CGZ47_RS07845 (CGZ47_07845) | - | 1501519..1502571 (+) | 1053 | WP_089541951.1 | IS30 family transposase | - |
| CGZ47_RS10490 | - | 1502592..1502750 (-) | 159 | WP_157696701.1 | hypothetical protein | - |
| CGZ47_RS07850 (CGZ47_07850) | - | 1502863..1503504 (-) | 642 | WP_076789971.1 | NAD(P)H-binding protein | - |
| CGZ47_RS07855 (CGZ47_07855) | - | 1503961..1505157 (-) | 1197 | WP_089542293.1 | LPXTG cell wall anchor domain-containing protein | - |
| CGZ47_RS07860 (CGZ47_07860) | - | 1505337..1507349 (-) | 2013 | WP_089542294.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| CGZ47_RS07865 (CGZ47_07865) | - | 1507447..1508841 (-) | 1395 | WP_076835046.1 | adhesive domain-containing protein | - |
| CGZ47_RS07870 (CGZ47_07870) | - | 1509195..1510136 (-) | 942 | WP_198331808.1 | nucleoside hydrolase | - |
| CGZ47_RS07875 (CGZ47_07875) | - | 1510286..1511257 (-) | 972 | WP_076787825.1 | LacI family DNA-binding transcriptional regulator | - |
| CGZ47_RS10780 | - | 1511271..1511915 (-) | 645 | WP_248618783.1 | glycoside hydrolase family 3 C-terminal domain-containing protein | - |
| CGZ47_RS07880 (CGZ47_07880) | - | 1511897..1513552 (-) | 1656 | WP_260315558.1 | glycoside hydrolase family 3 protein | - |
| CGZ47_RS07885 (CGZ47_07885) | - | 1513563..1514879 (-) | 1317 | WP_081395388.1 | PTS sugar transporter subunit IIC | - |
| CGZ47_RS07890 (CGZ47_07890) | clpP | 1515488..1516072 (+) | 585 | WP_004265909.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | - |
| CGZ47_RS07895 (CGZ47_07895) | - | 1516165..1517525 (-) | 1361 | Protein_1535 | IS3 family transposase | - |
| CGZ47_RS07900 (CGZ47_07900) | - | 1517651..1518169 (+) | 519 | WP_056966221.1 | DsbA family protein | - |
| CGZ47_RS07905 (CGZ47_07905) | - | 1518274..1518729 (-) | 456 | WP_004265929.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| CGZ47_RS07910 (CGZ47_07910) | whiA | 1518820..1519764 (-) | 945 | WP_004265894.1 | DNA-binding protein WhiA | - |
| CGZ47_RS07915 (CGZ47_07915) | - | 1519767..1520801 (-) | 1035 | WP_039098449.1 | gluconeogenesis factor YvcK family protein | - |
| CGZ47_RS07920 (CGZ47_07920) | rapZ | 1520798..1521682 (-) | 885 | WP_089542296.1 | RNase adapter RapZ | - |
| CGZ47_RS07925 (CGZ47_07925) | - | 1521884..1522420 (-) | 537 | WP_004265944.1 | HdeD family acid-resistance protein | - |
| CGZ47_RS07930 (CGZ47_07930) | uvrA | 1522575..1525427 (-) | 2853 | WP_089542297.1 | excinuclease ABC subunit UvrA | - |
| CGZ47_RS07935 (CGZ47_07935) | uvrB | 1525440..1527443 (-) | 2004 | WP_004265948.1 | excinuclease ABC subunit UvrB | - |
| CGZ47_RS07940 (CGZ47_07940) | - | 1527860..1528492 (-) | 633 | WP_004265951.1 | YfbR-like 5'-deoxynucleotidase | - |
| CGZ47_RS07945 (CGZ47_07945) | - | 1528605..1530329 (-) | 1725 | WP_089542298.1 | phospho-sugar mutase | - |
| CGZ47_RS07950 (CGZ47_07950) | trxB | 1530659..1531579 (-) | 921 | WP_039099207.1 | thioredoxin-disulfide reductase | - |
| CGZ47_RS07955 (CGZ47_07955) | - | 1531667..1532077 (-) | 411 | WP_039099209.1 | hypothetical protein | - |
| CGZ47_RS07960 (CGZ47_07960) | - | 1532189..1533217 (-) | 1029 | WP_039099211.1 | NAD(P)H-dependent glycerol-3-phosphate dehydrogenase | - |
| CGZ47_RS07965 (CGZ47_07965) | lgt | 1533245..1534078 (-) | 834 | WP_004265937.1 | prolipoprotein diacylglyceryl transferase | - |
| CGZ47_RS07970 (CGZ47_07970) | hprK | 1534445..1535386 (-) | 942 | WP_004265923.1 | HPr(Ser) kinase/phosphatase | - |
| CGZ47_RS07975 (CGZ47_07975) | - | 1535531..1535884 (-) | 354 | WP_004265953.1 | phage holin family protein | - |
| CGZ47_RS07980 (CGZ47_07980) | - | 1535884..1536183 (-) | 300 | WP_004265882.1 | hypothetical protein | - |
| CGZ47_RS07985 (CGZ47_07985) | - | 1536183..1536416 (-) | 234 | WP_035186190.1 | PspC domain-containing protein | - |
| CGZ47_RS07990 (CGZ47_07990) | liaX | 1536444..1537898 (-) | 1455 | WP_004265927.1 | daptomycin-sensing surface protein LiaX | - |
| CGZ47_RS07995 (CGZ47_07995) | - | 1538124..1538798 (+) | 675 | WP_089542299.1 | helix-turn-helix domain-containing protein | - |
| CGZ47_RS08000 (CGZ47_08000) | - | 1538795..1539676 (+) | 882 | WP_089542300.1 | IS3 family transposase | - |
| CGZ47_RS08005 (CGZ47_08005) | - | 1539749..1540219 (-) | 471 | WP_004270223.1 | nucleoside 2-deoxyribosyltransferase | - |
| CGZ47_RS08010 (CGZ47_08010) | phoU | 1540294..1540971 (-) | 678 | WP_004270249.1 | phosphate signaling complex protein PhoU | - |
| CGZ47_RS08015 (CGZ47_08015) | pstB | 1540990..1541748 (-) | 759 | WP_004270242.1 | phosphate ABC transporter ATP-binding protein PstB | - |
| CGZ47_RS08020 (CGZ47_08020) | pstB | 1541769..1542578 (-) | 810 | WP_089542301.1 | phosphate ABC transporter ATP-binding protein PstB | - |
| CGZ47_RS08025 (CGZ47_08025) | pstA | 1542588..1543472 (-) | 885 | WP_004270246.1 | phosphate ABC transporter permease PstA | - |
| CGZ47_RS08030 (CGZ47_08030) | pstC | 1543472..1544395 (-) | 924 | WP_004270247.1 | phosphate ABC transporter permease subunit PstC | - |
| CGZ47_RS08035 (CGZ47_08035) | - | 1544406..1545266 (-) | 861 | WP_065825893.1 | phosphate ABC transporter substrate-binding protein PstS family protein | - |
| CGZ47_RS08040 (CGZ47_08040) | pnpS | 1545361..1547022 (-) | 1662 | WP_065825894.1 | two-component system histidine kinase PnpS | - |
| CGZ47_RS08045 (CGZ47_08045) | - | 1547009..1547722 (-) | 714 | WP_004270257.1 | response regulator transcription factor | - |
| CGZ47_RS08050 (CGZ47_08050) | - | 1547743..1548873 (-) | 1131 | WP_232505344.1 | PDZ domain-containing protein | - |
| CGZ47_RS08055 (CGZ47_08055) | - | 1549078..1550450 (+) | 1373 | WP_089542303.1 | IS3 family transposase | - |
| CGZ47_RS08060 (CGZ47_08060) | ftsX | 1550522..1551409 (-) | 888 | WP_004270230.1 | permease-like cell division protein FtsX | - |
| CGZ47_RS08065 (CGZ47_08065) | ftsE | 1551399..1552076 (-) | 678 | WP_375709515.1 | cell division ATP-binding protein FtsE | - |
| CGZ47_RS08075 (CGZ47_08075) | secA | 1553404..1555767 (-) | 2364 | WP_076787039.1 | preprotein translocase subunit SecA | - |
| CGZ47_RS08080 (CGZ47_08080) | hpf | 1555996..1556541 (-) | 546 | WP_004270226.1 | ribosome hibernation-promoting factor, HPF/YfiA family | - |
| CGZ47_RS08085 (CGZ47_08085) | comFC | 1556667..1557197 (-) | 531 | WP_148484979.1 | ComF family protein | Machinery gene |
| CGZ47_RS08090 (CGZ47_08090) | comFA | 1557341..1558675 (-) | 1335 | WP_100069772.1 | DEAD/DEAH box helicase | Machinery gene |
| CGZ47_RS08095 (CGZ47_08095) | - | 1558732..1559394 (+) | 663 | WP_004270231.1 | YigZ family protein | - |
| CGZ47_RS08100 (CGZ47_08100) | - | 1559419..1560507 (-) | 1089 | WP_004270225.1 | glycosyltransferase family 4 protein | - |
| CGZ47_RS08105 (CGZ47_08105) | hemH | 1560617..1561568 (-) | 952 | Protein_1577 | ferrochelatase | - |
| CGZ47_RS08110 (CGZ47_08110) | rny | 1561568..1563130 (-) | 1563 | WP_076789162.1 | ribonuclease Y | - |
| CGZ47_RS08115 (CGZ47_08115) | recA | 1563374..1564432 (-) | 1059 | WP_004270239.1 | recombinase RecA | Machinery gene |
| CGZ47_RS08120 (CGZ47_08120) | pgsA | 1564625..1565209 (-) | 585 | WP_004270254.1 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase | - |
| CGZ47_RS08125 (CGZ47_08125) | - | 1565232..1566155 (-) | 924 | WP_004270224.1 | helix-turn-helix domain-containing protein | - |
| CGZ47_RS08130 (CGZ47_08130) | ymfI | 1566238..1566966 (-) | 729 | WP_089542305.1 | elongation factor P 5-aminopentanone reductase | - |
| CGZ47_RS08135 (CGZ47_08135) | yfmH | 1566959..1568269 (-) | 1311 | WP_089542306.1 | EF-P 5-aminopentanol modification-associated protein YfmH | - |
| CGZ47_RS08140 (CGZ47_08140) | yfmF | 1568259..1569530 (-) | 1272 | WP_089542307.1 | EF-P 5-aminopentanol modification-associated protein YfmF | - |
| CGZ47_RS08145 (CGZ47_08145) | - | 1569702..1570583 (-) | 882 | WP_089542300.1 | IS3 family transposase | - |
| CGZ47_RS08150 (CGZ47_08150) | - | 1570580..1571254 (-) | 675 | WP_089542308.1 | helix-turn-helix domain-containing protein | - |
| CGZ47_RS08155 (CGZ47_08155) | - | 1571470..1573818 (-) | 2349 | WP_089542309.1 | FtsK/SpoIIIE family DNA translocase | - |
| CGZ47_RS08160 (CGZ47_08160) | - | 1573960..1574361 (-) | 402 | WP_089542310.1 | DUF1149 family protein | - |
| CGZ47_RS08165 (CGZ47_08165) | trmL | 1574374..1574883 (-) | 510 | WP_054644125.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| CGZ47_RS08170 (CGZ47_08170) | - | 1575137..1575970 (-) | 834 | WP_089542311.1 | methyltransferase domain-containing protein | - |
Sequence
Protein
Download Length: 176 a.a. Molecular weight: 20693.79 Da Isoelectric Point: 9.7337
>NTDB_id=239844 CGZ47_RS08085 WP_148484979.1 1556667..1557197(-) (comFC) [Latilactobacillus curvatus strain KG6]
MTTQGVCPDCQRWQQLYPGEQFTNRALLTYNEPMQQYFQRYKGQGDYRLRHVFQRLIRENFPVQRQTAYIPVPTDPTHLQ
SRGFNPVVGLYEDCFPLTPLLQKLPTEKGQAQKNRAERLATPQFFKCAQNVLLSSKVQQLILLDDIYTTGRTLWHAQQCL
RKRYQTLPIHAITLVH
MTTQGVCPDCQRWQQLYPGEQFTNRALLTYNEPMQQYFQRYKGQGDYRLRHVFQRLIRENFPVQRQTAYIPVPTDPTHLQ
SRGFNPVVGLYEDCFPLTPLLQKLPTEKGQAQKNRAERLATPQFFKCAQNVLLSSKVQQLILLDDIYTTGRTLWHAQQCL
RKRYQTLPIHAITLVH
Nucleotide
Download Length: 531 bp
>NTDB_id=239844 CGZ47_RS08085 WP_148484979.1 1556667..1557197(-) (comFC) [Latilactobacillus curvatus strain KG6]
ATGACAACCCAGGGGGTGTGTCCGGATTGCCAGAGATGGCAGCAACTGTATCCAGGCGAACAATTTACTAATCGAGCGTT
GTTAACATACAACGAACCAATGCAACAGTATTTTCAACGCTATAAGGGGCAGGGGGATTATCGATTACGTCACGTATTTC
AACGGCTGATTCGAGAAAATTTTCCTGTGCAACGGCAAACGGCGTATATCCCAGTCCCGACTGATCCAACACATTTGCAA
AGCCGCGGATTCAATCCGGTGGTTGGCTTATACGAGGACTGTTTTCCACTGACCCCATTGTTGCAGAAGCTACCAACTGA
AAAAGGACAAGCACAAAAAAATCGTGCAGAGCGCTTAGCAACGCCGCAATTTTTTAAATGCGCGCAGAACGTGCTGTTGA
GTTCCAAGGTGCAGCAGTTAATTTTGTTGGATGATATTTATACCACTGGGCGCACGTTATGGCATGCTCAGCAGTGTCTC
CGCAAGCGATACCAAACGCTGCCAATTCACGCAATTACTTTAGTCCACTAG
ATGACAACCCAGGGGGTGTGTCCGGATTGCCAGAGATGGCAGCAACTGTATCCAGGCGAACAATTTACTAATCGAGCGTT
GTTAACATACAACGAACCAATGCAACAGTATTTTCAACGCTATAAGGGGCAGGGGGATTATCGATTACGTCACGTATTTC
AACGGCTGATTCGAGAAAATTTTCCTGTGCAACGGCAAACGGCGTATATCCCAGTCCCGACTGATCCAACACATTTGCAA
AGCCGCGGATTCAATCCGGTGGTTGGCTTATACGAGGACTGTTTTCCACTGACCCCATTGTTGCAGAAGCTACCAACTGA
AAAAGGACAAGCACAAAAAAATCGTGCAGAGCGCTTAGCAACGCCGCAATTTTTTAAATGCGCGCAGAACGTGCTGTTGA
GTTCCAAGGTGCAGCAGTTAATTTTGTTGGATGATATTTATACCACTGGGCGCACGTTATGGCATGCTCAGCAGTGTCTC
CGCAAGCGATACCAAACGCTGCCAATTCACGCAATTACTTTAGTCCACTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comFC | Latilactobacillus sakei subsp. sakei 23K |
65.493 |
80.682 |
0.528 |