Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   CEQ19_RS06715 Genome accession   NZ_CP022044
Coordinates   1215306..1216085 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus anthracis strain FDAARGOS_341     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1180984..1254907 1215306..1216085 within 0


Gene organization within MGE regions


Location: 1180984..1254907
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CEQ19_RS06550 (CEQ19_06595) - 1181328..1182998 (-) 1671 WP_000823085.1 ribonuclease J -
  CEQ19_RS06560 (CEQ19_06605) dapA 1183764..1184642 (-) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  CEQ19_RS06565 (CEQ19_06610) dapG 1184654..1185886 (-) 1233 WP_000692470.1 aspartate kinase -
  CEQ19_RS06570 (CEQ19_06615) asd 1185910..1186956 (-) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  CEQ19_RS06575 (CEQ19_06620) dpaB 1187107..1187706 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  CEQ19_RS06580 (CEQ19_06625) dpaA 1187703..1188605 (-) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  CEQ19_RS06590 (CEQ19_06635) - 1188880..1189131 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  CEQ19_RS06595 (CEQ19_06640) - 1189258..1190499 (-) 1242 WP_000592993.1 pitrilysin family protein -
  CEQ19_RS06600 (CEQ19_06645) - 1190586..1191485 (-) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  CEQ19_RS06605 (CEQ19_06650) pnp 1191637..1193775 (-) 2139 WP_000076733.1 polyribonucleotide nucleotidyltransferase -
  CEQ19_RS06610 (CEQ19_06655) rpsO 1193936..1194205 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  CEQ19_RS06615 (CEQ19_06660) ribF 1194306..1195277 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  CEQ19_RS06620 (CEQ19_06665) truB 1195321..1196244 (-) 924 WP_000399357.1 tRNA pseudouridine(55) synthase TruB -
  CEQ19_RS06625 (CEQ19_06670) rbfA 1196331..1196687 (-) 357 WP_000776446.1 30S ribosome-binding factor RbfA -
  CEQ19_RS06630 (CEQ19_06675) - 1196703..1196984 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  CEQ19_RS06635 (CEQ19_06680) infB 1196981..1199041 (-) 2061 WP_000036339.1 translation initiation factor IF-2 -
  CEQ19_RS06640 (CEQ19_06685) - 1199046..1199357 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  CEQ19_RS06645 (CEQ19_06690) rnpM 1199358..1199630 (-) 273 WP_000071128.1 RNase P modulator RnpM -
  CEQ19_RS06650 (CEQ19_06695) nusA 1199642..1200748 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  CEQ19_RS06655 (CEQ19_06700) rimP 1200766..1201236 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  CEQ19_RS06660 (CEQ19_06705) - 1201569..1205870 (-) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  CEQ19_RS06670 (CEQ19_06715) - 1205995..1207695 (-) 1701 WP_000814312.1 proline--tRNA ligase -
  CEQ19_RS06675 (CEQ19_06720) rseP 1207805..1209061 (-) 1257 WP_001090228.1 RIP metalloprotease RseP -
  CEQ19_RS06680 (CEQ19_06725) dxr 1209078..1210220 (-) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  CEQ19_RS06685 (CEQ19_06730) cdsA 1210244..1211035 (-) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  CEQ19_RS06690 (CEQ19_06735) uppS 1211053..1211829 (-) 777 WP_000971303.1 isoprenyl transferase -
  CEQ19_RS06695 (CEQ19_06740) frr 1211915..1212472 (-) 558 WP_000531498.1 ribosome recycling factor -
  CEQ19_RS06700 (CEQ19_06745) pyrH 1212475..1213197 (-) 723 WP_000042663.1 UMP kinase -
  CEQ19_RS06705 (CEQ19_06750) tsf 1213264..1214151 (-) 888 WP_001018581.1 translation elongation factor Ts -
  CEQ19_RS06710 (CEQ19_06755) rpsB 1214255..1214956 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  CEQ19_RS06715 (CEQ19_06760) codY 1215306..1216085 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  CEQ19_RS06720 (CEQ19_06765) hslU 1216163..1217554 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  CEQ19_RS06725 (CEQ19_06770) hslV 1217577..1218119 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  CEQ19_RS06730 (CEQ19_06775) xerC 1218162..1219061 (-) 900 WP_001101226.1 tyrosine recombinase XerC -
  CEQ19_RS06735 (CEQ19_06780) trmFO 1219127..1220431 (-) 1305 WP_003161605.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  CEQ19_RS06740 (CEQ19_06785) topA 1220482..1222560 (-) 2079 WP_001286969.1 type I DNA topoisomerase -
  CEQ19_RS06745 (CEQ19_06790) dprA 1222705..1223453 (-) 749 Protein_1256 DNA-processing protein DprA -
  CEQ19_RS06750 (CEQ19_06795) sucD 1223661..1224563 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  CEQ19_RS06755 (CEQ19_06800) sucC 1224584..1225744 (-) 1161 WP_001020786.1 ADP-forming succinate--CoA ligase subunit beta -
  CEQ19_RS06760 (CEQ19_06805) rnhB 1225938..1226711 (-) 774 WP_001174712.1 ribonuclease HII -
  CEQ19_RS06765 (CEQ19_06810) ylqF 1226763..1227653 (-) 891 WP_000236707.1 ribosome biogenesis GTPase YlqF -
  CEQ19_RS06770 (CEQ19_06815) lepB 1227674..1228225 (-) 552 WP_000711857.1 signal peptidase I -
  CEQ19_RS06775 (CEQ19_06820) rplS 1228327..1228671 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  CEQ19_RS06780 (CEQ19_06825) trmD 1228818..1229552 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  CEQ19_RS06785 (CEQ19_06830) rimM 1229552..1230067 (-) 516 WP_000170269.1 ribosome maturation factor RimM -
  CEQ19_RS06790 (CEQ19_06835) - 1230188..1230415 (-) 228 WP_000737398.1 KH domain-containing protein -
  CEQ19_RS06795 (CEQ19_06840) rpsP 1230430..1230702 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  CEQ19_RS06800 (CEQ19_06845) ffh 1230803..1232152 (-) 1350 WP_000863456.1 signal recognition particle protein -
  CEQ19_RS06805 (CEQ19_06850) - 1232165..1232497 (-) 333 WP_000891062.1 putative DNA-binding protein -
  CEQ19_RS06810 (CEQ19_06855) ftsY 1232630..1233619 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  CEQ19_RS06815 (CEQ19_06860) smc 1233635..1237204 (-) 3570 WP_000478985.1 chromosome segregation protein SMC -
  CEQ19_RS06820 (CEQ19_06865) rncS 1237351..1238088 (-) 738 WP_001146873.1 ribonuclease III -
  CEQ19_RS06825 (CEQ19_06870) acpP 1238147..1238380 (-) 234 WP_000786062.1 acyl carrier protein -
  CEQ19_RS06830 (CEQ19_06875) fabG 1238450..1239190 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  CEQ19_RS06835 (CEQ19_06880) fabD 1239190..1240134 (-) 945 WP_000516958.1 ACP S-malonyltransferase -
  CEQ19_RS06840 (CEQ19_06885) plsX 1240149..1241141 (-) 993 WP_000684111.1 phosphate acyltransferase PlsX -
  CEQ19_RS06845 (CEQ19_06890) fapR 1241138..1241731 (-) 594 WP_000747352.1 transcription factor FapR -
  CEQ19_RS06850 (CEQ19_06895) recG 1241820..1243868 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  CEQ19_RS06855 (CEQ19_06900) - 1244158..1245834 (-) 1677 WP_000027136.1 DAK2 domain-containing protein -
  CEQ19_RS06860 (CEQ19_06905) - 1245857..1246219 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  CEQ19_RS06865 (CEQ19_06910) rpmB 1246598..1246786 (+) 189 WP_000124778.1 50S ribosomal protein L28 -
  CEQ19_RS06870 (CEQ19_06915) spoVM 1246859..1246939 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  CEQ19_RS06875 (CEQ19_06920) - 1247006..1247686 (-) 681 WP_025388434.1 thiamine diphosphokinase -
  CEQ19_RS06880 (CEQ19_06925) rpe 1247786..1248430 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  CEQ19_RS06885 (CEQ19_06930) rsgA 1248433..1249314 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  CEQ19_RS06890 (CEQ19_06935) prkC 1249583..1251556 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  CEQ19_RS06895 (CEQ19_06940) - 1251565..1252317 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  CEQ19_RS06900 (CEQ19_06945) rlmN 1252322..1253410 (-) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  CEQ19_RS06905 (CEQ19_06950) rsmB 1253415..1254749 (-) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=236099 CEQ19_RS06715 WP_000421288.1 1215306..1216085(-) (codY) [Bacillus anthracis strain FDAARGOS_341]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=236099 CEQ19_RS06715 WP_000421288.1 1215306..1216085(-) (codY) [Bacillus anthracis strain FDAARGOS_341]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459

Multiple sequence alignment