Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   CA592_RS00665 Genome accession   NZ_CP021838
Coordinates   118979..119275 (+) Length   98 a.a.
NCBI ID   WP_006317959.1    Uniprot ID   -
Organism   Anoxybacillus flavithermus strain 52-1A     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 113979..124275
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CA592_RS00640 (CA592_00640) - 114389..115492 (+) 1104 WP_088223205.1 class I SAM-dependent methyltransferase -
  CA592_RS00645 (CA592_00645) - 115522..115764 (-) 243 WP_004889537.1 DUF2626 domain-containing protein -
  CA592_RS00650 (CA592_00650) - 115834..116532 (-) 699 WP_004889538.1 helix-turn-helix transcriptional regulator -
  CA592_RS00655 (CA592_00655) comGA 116885..117955 (+) 1071 WP_004889540.1 competence type IV pilus ATPase ComGA Machinery gene
  CA592_RS00660 (CA592_00660) comGB 117939..118970 (+) 1032 WP_004889541.1 competence type IV pilus assembly protein ComGB -
  CA592_RS00665 (CA592_00665) comGC 118979..119275 (+) 297 WP_006317959.1 competence type IV pilus major pilin ComGC Machinery gene
  CA592_RS00670 (CA592_00670) comGD 119268..119705 (+) 438 WP_004889545.1 competence type IV pilus minor pilin ComGD -
  CA592_RS00675 (CA592_00675) comGE 119689..119997 (+) 309 WP_004889546.1 competence type IV pilus minor pilin ComGE -
  CA592_RS00680 (CA592_00680) comGF 119994..120428 (+) 435 WP_004889548.1 competence type IV pilus minor pilin ComGF -
  CA592_RS00685 (CA592_00685) comGG 120388..120804 (+) 417 WP_035018541.1 competence type IV pilus minor pilin ComGG -
  CA592_RS00690 (CA592_00690) - 120819..121325 (+) 507 WP_004889550.1 shikimate kinase -
  CA592_RS00695 (CA592_00695) - 121352..121540 (+) 189 WP_004889551.1 YqzE family protein -
  CA592_RS00700 (CA592_00700) - 121555..122325 (-) 771 WP_004889552.1 YqhG family protein -
  CA592_RS00705 (CA592_00705) - 122312..123955 (-) 1644 WP_004889553.1 DEAD/DEAH box helicase -

Sequence

Protein


Download         Length: 98 a.a.        Molecular weight: 10977.90 Da        Isoelectric Point: 5.6720

>NTDB_id=233684 CA592_RS00665 WP_006317959.1 118979..119275(+) (comGC) [Anoxybacillus flavithermus strain 52-1A]
MRNEKGFTLIEMLIVLMVITILILITIPNVTKHNSMINNKGCSAFIKMVQSQVKAYEMEHGTIPTVQQLVDGKYIESNRC
PNGKEIVITNEGDVLEGE

Nucleotide


Download         Length: 297 bp        

>NTDB_id=233684 CA592_RS00665 WP_006317959.1 118979..119275(+) (comGC) [Anoxybacillus flavithermus strain 52-1A]
ATGCGAAATGAGAAAGGGTTTACATTAATTGAAATGTTAATTGTGCTAATGGTTATCACAATTTTAATTTTAATTACGAT
TCCAAATGTGACAAAACATAACAGCATGATTAACAACAAAGGGTGTTCGGCTTTTATAAAAATGGTTCAATCCCAAGTGA
AAGCATACGAAATGGAGCACGGTACAATCCCGACTGTGCAACAATTAGTAGATGGAAAATATATTGAGAGCAACCGTTGC
CCAAATGGAAAAGAGATTGTTATTACAAATGAAGGAGACGTTTTAGAAGGTGAATGA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(1-26)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

55.056

90.816

0.5

Multiple sequence alignment